SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 375716 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  375716
Domain Number 1 Region: 10-342
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.04e-49
Family AAT-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 375716
Sequence length 345
Comment $ JCSG $ SQ128522 $ PDBT33251 $
Sequence
MQWLTFQWLEFIREYREKAKHNLSNSGMPEPDLKSLGIDTSYEHYLDAAGEVEYRFTEAL
SRRLRVDQDLIIPTVGGTEAIFIALSHLSSVSKRIHVPLPEYEPMFLVPESLGIETSKIE
SKVMPGRISKNESIAMTLPNNPTAQYSDRISLLDNVIHSEGLIYIDETFRDFLPSGTRPT
LFDGSETMVVSGTMTKFYGLSNLRTGWIISSEHNVAGMRRIKDLTSINNASFSLYIAAQA
IQKWNYFKEAEDNLINKNLRVAREYLEGLPGISYKEPEGAPFIFLSYSKNIESVKLAKLA
VERYGILFAPGSFFGEEHHIRVCLTSNKPEEDFNVLKEFLKKEAV
Download sequence
Identical sequences Q97BG0
WP_010916754.1.10044 375716 APC88399 273116.TVN0496 gi|13541327|ref|NP_111015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]