SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 392886 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392886
Domain Number 1 Region: 138-207
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.00000282
Family MJ1460-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 392886
Sequence length 212
Comment $ JCSG $ SQ169952 $ PDBT42796 $
Sequence
MTSVEAFRGLYYPNKIGRLCFLSLEEVMGQNGVKALLRLADLQQYIDAYPPNDLKREFPF
EAISKYSVALGTMYGPRGARGLELRAGRVAFSLGLKEFGPLLGMADLALKLMPITMKLKI
VLNATAQTFDRFSDQSSHVEEERGRFVYHITRCSNCITRPEPGPVFYIARGILEEATAWV
SGGRRFAVEQLSCMGQGNCSSCAFAIGKDPLE
Download sequence
Identical sequences A9WDP1
324602.Caur_0397 480224.Chy400_0423 WP_012256303.1.35445 YP_001634036.1.55443 gi|222523717|ref|YP_002568187.1| 2005463477 gi|163845992|ref|YP_001634036.1| 392886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]