SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 400161 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400161
Domain Number 1 Region: 103-237
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.34e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0000128
Further Details:      
 
Domain Number 2 Region: 24-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 400161
Sequence length 243
Comment $ JCSG $ SQ198273 $ PDBT46685 $
Sequence
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC
Download sequence
Identical sequences Q9H4Y5
NP_899062.1.87134 NP_899062.1.92137 XP_011537572.1.92137 ENSP00000345023 ENSP00000345023 ENSP00000345023 9606.ENSP00000345023 400161 gi|38016131|ref|NP_899062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]