SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC24643 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC24643
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.01e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC24643
Sequence length 106
Comment $ MCSG $ SQ18558 $ PDBT64018 $
Sequence
MADMQTPFALILHGGNARSAALEAIAFARQGDFGNAGEKMKLASEEISAAHRIQTDLIQE
EARGNHAEISLLLVHAQDHLMNAITVKELAEEFIALHKRVEEKVTV
Download sequence
Identical sequences A0A023P2V4 A0A0A3W057 A0A0E8TCY3 A0A0F6FXZ2 A0A0G4D625 A0A0K0S3A7 A0A0W7Y100 A0A135WCM2 A0A193CNT7 A0A1C9BNW3 A0A1E7ZX23 A0A1G1UN58 A0A1M6P527 A0A1Q9KMW6 A0A1W2GV25 A0A229MCW0 A0A242YNS0 A0A243C8K9 A0A243DSQ1 A0A243F7E5 A0A243IM23 A0A243KJG1 A0A243L3W0 A0A243N0A2 B5UJL3 C2R3W6 C2SWP2 C2U9N5 C2WIA2 C2X7K3 G9Q942 J7Z5X3 J8HHE4 J8IC46 J8N0X0 J8NYH4 N1LUM8 Q81HJ9 R8F0M2 R8GXT3 R8N8F8 R8QL75 R8UEC3 W8Y708
NP_830597.1.86172 WP_000774631.1.100082 WP_000774631.1.10055 WP_000774631.1.100912 WP_000774631.1.101224 WP_000774631.1.10688 WP_000774631.1.10845 WP_000774631.1.1112 WP_000774631.1.11584 WP_000774631.1.12553 WP_000774631.1.1354 WP_000774631.1.14006 WP_000774631.1.14174 WP_000774631.1.14176 WP_000774631.1.18749 WP_000774631.1.19438 WP_000774631.1.19516 WP_000774631.1.20208 WP_000774631.1.20651 WP_000774631.1.2206 WP_000774631.1.2251 WP_000774631.1.22699 WP_000774631.1.23181 WP_000774631.1.23307 WP_000774631.1.23652 WP_000774631.1.24795 WP_000774631.1.25290 WP_000774631.1.25599 WP_000774631.1.26483 WP_000774631.1.26513 WP_000774631.1.26637 WP_000774631.1.26826 WP_000774631.1.26872 WP_000774631.1.27106 WP_000774631.1.27931 WP_000774631.1.28237 WP_000774631.1.29836 WP_000774631.1.29993 WP_000774631.1.31221 WP_000774631.1.32784 WP_000774631.1.32927 WP_000774631.1.33201 WP_000774631.1.33717 WP_000774631.1.34175 WP_000774631.1.34587 WP_000774631.1.35694 WP_000774631.1.37239 WP_000774631.1.3798 WP_000774631.1.38345 WP_000774631.1.38427 WP_000774631.1.38591 WP_000774631.1.39411 WP_000774631.1.39957 WP_000774631.1.40430 WP_000774631.1.41464 WP_000774631.1.41518 WP_000774631.1.4185 WP_000774631.1.41879 WP_000774631.1.42167 WP_000774631.1.42218 WP_000774631.1.43442 WP_000774631.1.43767 WP_000774631.1.43914 WP_000774631.1.44348 WP_000774631.1.44428 WP_000774631.1.44497 WP_000774631.1.44956 WP_000774631.1.45720 WP_000774631.1.46326 WP_000774631.1.47000 WP_000774631.1.47437 WP_000774631.1.49455 WP_000774631.1.4964 WP_000774631.1.49702 WP_000774631.1.5025 WP_000774631.1.50694 WP_000774631.1.51047 WP_000774631.1.51072 WP_000774631.1.51681 WP_000774631.1.54142 WP_000774631.1.54240 WP_000774631.1.54547 WP_000774631.1.54736 WP_000774631.1.54777 WP_000774631.1.55077 WP_000774631.1.55116 WP_000774631.1.5543 WP_000774631.1.58586 WP_000774631.1.58632 WP_000774631.1.58822 WP_000774631.1.59058 WP_000774631.1.59997 WP_000774631.1.60153 WP_000774631.1.60334 WP_000774631.1.61243 WP_000774631.1.62770 WP_000774631.1.6304 WP_000774631.1.63743 WP_000774631.1.63789 WP_000774631.1.64282 WP_000774631.1.64568 WP_000774631.1.6475 WP_000774631.1.64764 WP_000774631.1.65803 WP_000774631.1.66999 WP_000774631.1.67001 WP_000774631.1.674 WP_000774631.1.6743 WP_000774631.1.67873 WP_000774631.1.67912 WP_000774631.1.68007 WP_000774631.1.6816 WP_000774631.1.68346 WP_000774631.1.6846 WP_000774631.1.68562 WP_000774631.1.69501 WP_000774631.1.70108 WP_000774631.1.70181 WP_000774631.1.71114 WP_000774631.1.71242 WP_000774631.1.72484 WP_000774631.1.73396 WP_000774631.1.73790 WP_000774631.1.74302 WP_000774631.1.74372 WP_000774631.1.74832 WP_000774631.1.74857 WP_000774631.1.74976 WP_000774631.1.76155 WP_000774631.1.76804 WP_000774631.1.76883 WP_000774631.1.76902 WP_000774631.1.77386 WP_000774631.1.77567 WP_000774631.1.80126 WP_000774631.1.80649 WP_000774631.1.81000 WP_000774631.1.81570 WP_000774631.1.83694 WP_000774631.1.83977 WP_000774631.1.85348 WP_000774631.1.85592 WP_000774631.1.85928 WP_000774631.1.86374 WP_000774631.1.86619 WP_000774631.1.86637 WP_000774631.1.869 WP_000774631.1.87013 WP_000774631.1.87725 WP_000774631.1.87768 WP_000774631.1.87777 WP_000774631.1.87947 WP_000774631.1.88154 WP_000774631.1.88200 WP_000774631.1.89009 WP_000774631.1.89718 WP_000774631.1.90466 WP_000774631.1.90665 WP_000774631.1.93683 WP_000774631.1.93838 WP_000774631.1.94308 WP_000774631.1.9533 WP_000774631.1.95576 WP_000774631.1.9623 WP_000774631.1.96287 WP_000774631.1.96437 WP_000774631.1.97082 WP_000774631.1.97262 WP_000774631.1.97842 WP_000774631.1.97993 WP_000774631.1.9860 WP_000774631.1.98604 gi|449087581|ref|YP_007420022.1| gi|30018966|ref|NP_830597.1| gi|296501531|ref|YP_003663231.1| 226900.BC0807 APC24643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]