SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC26210 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC26210
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.22e-38
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC26210
Sequence length 105
Comment $ MCSG $ SQ20015 $ PDBT65559 $
Sequence
MDTIETKAFHLILHGGNARSCSMEAIDCAKRGEFTEAEAKLQEALEELKEAHRVQTELIQ
KEAGGEKTEVTLLMVHAQDHLMNAITVKELASEFVELYRKMSVDE
Download sequence
Identical sequences A0A023PEG5 A0A0A3VIT2 A0A0D1PSQ4 A0A0E8T2N1 A0A0F6FLK0 A0A0F6J727 A0A0G3E2F2 A0A0G4CU10 A0A0K0SG31 A0A0Q9FAS3 A0A0Q9FS38 A0A0W7YEU1 A0A135WNC6 A0A160LGP2 A0A193D021 A0A1C9C1P3 A0A1H6AS77 A0A1I4KY52 A0A1M6FHA3 A0A1M7CZB6 A0A1Q9KSQ9 A0A1W2GBL0 A0A229MIP6 A0A242Y9B9 A0A242YR29 A0A243AFC0 A0A243BIT2 A0A243D357 A0A243ENA6 A0A243F5T1 A0A243FMZ7 A0A243HMC0 A0A243J4C6 A0A243JRV5 A0A243K1J6 A0A243LUN0 A0A243MKQ8 A0A243NP97 A0A2A2P015 A0A2C9YVN2 A0A2H3R0T7 B5UQ06 B7IPX6 C2P6C3 C3DSY7 C3EB36 G9QCN4 J4A073 J7W8U6 J7YZN8 J8ESR6 J8HFR6 J8L4P5 J8LSU5 J8MEL5 J8N121 J8QNW5 J9CIM6 Q3EY19 Q815E6 R8C304 R8E5T6 R8E9Y4 R8FA90 R8G4S8 R8G875 R8GVT4 R8J2L5 R8JYX2 R8L1E2 R8P1E3 R8RB31 R8T7Z0 R8XVI8 V5ML57 W8YBB6
gi|384189291|ref|YP_005575187.1| gi|402563189|ref|YP_006605913.1| gi|410677620|ref|YP_006929991.1| APC26210 gi|30023247|ref|NP_834878.1| gi|434378328|ref|YP_006612972.1| NP_834878.1.86172 WP_000379645.1.100082 WP_000379645.1.100497 WP_000379645.1.10055 WP_000379645.1.100912 WP_000379645.1.101224 WP_000379645.1.101720 WP_000379645.1.101838 WP_000379645.1.10584 WP_000379645.1.10688 WP_000379645.1.10745 WP_000379645.1.10845 WP_000379645.1.1112 WP_000379645.1.11521 WP_000379645.1.11584 WP_000379645.1.12553 WP_000379645.1.12935 WP_000379645.1.13269 WP_000379645.1.1354 WP_000379645.1.13975 WP_000379645.1.14006 WP_000379645.1.14039 WP_000379645.1.14174 WP_000379645.1.14176 WP_000379645.1.17374 WP_000379645.1.18749 WP_000379645.1.18914 WP_000379645.1.19438 WP_000379645.1.19516 WP_000379645.1.20208 WP_000379645.1.20651 WP_000379645.1.21675 WP_000379645.1.2206 WP_000379645.1.22084 WP_000379645.1.22152 WP_000379645.1.2251 WP_000379645.1.22699 WP_000379645.1.23181 WP_000379645.1.23245 WP_000379645.1.23307 WP_000379645.1.23360 WP_000379645.1.23540 WP_000379645.1.23652 WP_000379645.1.24680 WP_000379645.1.25290 WP_000379645.1.25599 WP_000379645.1.26459 WP_000379645.1.26483 WP_000379645.1.26513 WP_000379645.1.26637 WP_000379645.1.26826 WP_000379645.1.26965 WP_000379645.1.27106 WP_000379645.1.27446 WP_000379645.1.27931 WP_000379645.1.28237 WP_000379645.1.28599 WP_000379645.1.29836 WP_000379645.1.29993 WP_000379645.1.31221 WP_000379645.1.3180 WP_000379645.1.3249 WP_000379645.1.32784 WP_000379645.1.32927 WP_000379645.1.33201 WP_000379645.1.33717 WP_000379645.1.33790 WP_000379645.1.34061 WP_000379645.1.34175 WP_000379645.1.34537 WP_000379645.1.34587 WP_000379645.1.3546 WP_000379645.1.35694 WP_000379645.1.35769 WP_000379645.1.36221 WP_000379645.1.36279 WP_000379645.1.37239 WP_000379645.1.3798 WP_000379645.1.38325 WP_000379645.1.38345 WP_000379645.1.38427 WP_000379645.1.38591 WP_000379645.1.39411 WP_000379645.1.39957 WP_000379645.1.40034 WP_000379645.1.40818 WP_000379645.1.41090 WP_000379645.1.41464 WP_000379645.1.41729 WP_000379645.1.4185 WP_000379645.1.41879 WP_000379645.1.42167 WP_000379645.1.42218 WP_000379645.1.42485 WP_000379645.1.43442 WP_000379645.1.43767 WP_000379645.1.43914 WP_000379645.1.44348 WP_000379645.1.44428 WP_000379645.1.4447 WP_000379645.1.44497 WP_000379645.1.44956 WP_000379645.1.45317 WP_000379645.1.45720 WP_000379645.1.46326 WP_000379645.1.47000 WP_000379645.1.47437 WP_000379645.1.47975 WP_000379645.1.48759 WP_000379645.1.49455 WP_000379645.1.4964 WP_000379645.1.49702 WP_000379645.1.50042 WP_000379645.1.5025 WP_000379645.1.50694 WP_000379645.1.51047 WP_000379645.1.51072 WP_000379645.1.51681 WP_000379645.1.52284 WP_000379645.1.54240 WP_000379645.1.54547 WP_000379645.1.54736 WP_000379645.1.54777 WP_000379645.1.55077 WP_000379645.1.55116 WP_000379645.1.5543 WP_000379645.1.56320 WP_000379645.1.57561 WP_000379645.1.58586 WP_000379645.1.58632 WP_000379645.1.58712 WP_000379645.1.58822 WP_000379645.1.5895 WP_000379645.1.59058 WP_000379645.1.59384 WP_000379645.1.59997 WP_000379645.1.60153 WP_000379645.1.60255 WP_000379645.1.60526 WP_000379645.1.61243 WP_000379645.1.61799 WP_000379645.1.61820 WP_000379645.1.61919 WP_000379645.1.62277 WP_000379645.1.6241 WP_000379645.1.62770 WP_000379645.1.6304 WP_000379645.1.63743 WP_000379645.1.63789 WP_000379645.1.63902 WP_000379645.1.64282 WP_000379645.1.64421 WP_000379645.1.64568 WP_000379645.1.64764 WP_000379645.1.65803 WP_000379645.1.67001 WP_000379645.1.674 WP_000379645.1.6743 WP_000379645.1.67873 WP_000379645.1.67912 WP_000379645.1.68007 WP_000379645.1.6816 WP_000379645.1.68346 WP_000379645.1.6846 WP_000379645.1.68562 WP_000379645.1.69347 WP_000379645.1.69501 WP_000379645.1.70108 WP_000379645.1.70181 WP_000379645.1.70667 WP_000379645.1.71242 WP_000379645.1.71652 WP_000379645.1.72484 WP_000379645.1.72752 WP_000379645.1.73396 WP_000379645.1.73457 WP_000379645.1.73594 WP_000379645.1.73638 WP_000379645.1.73790 WP_000379645.1.74372 WP_000379645.1.74832 WP_000379645.1.74857 WP_000379645.1.74863 WP_000379645.1.74976 WP_000379645.1.7534 WP_000379645.1.75866 WP_000379645.1.75891 WP_000379645.1.7593 WP_000379645.1.75942 WP_000379645.1.76086 WP_000379645.1.76155 WP_000379645.1.76804 WP_000379645.1.76883 WP_000379645.1.76902 WP_000379645.1.77567 WP_000379645.1.79549 WP_000379645.1.80126 WP_000379645.1.80622 WP_000379645.1.80649 WP_000379645.1.81000 WP_000379645.1.81570 WP_000379645.1.81773 WP_000379645.1.83666 WP_000379645.1.83694 WP_000379645.1.83977 WP_000379645.1.84541 WP_000379645.1.84775 WP_000379645.1.85348 WP_000379645.1.85592 WP_000379645.1.85667 WP_000379645.1.8577 WP_000379645.1.85928 WP_000379645.1.86374 WP_000379645.1.86619 WP_000379645.1.86637 WP_000379645.1.86763 WP_000379645.1.869 WP_000379645.1.87013 WP_000379645.1.87649 WP_000379645.1.87705 WP_000379645.1.87725 WP_000379645.1.87768 WP_000379645.1.87777 WP_000379645.1.87947 WP_000379645.1.88154 WP_000379645.1.88200 WP_000379645.1.88269 WP_000379645.1.89009 WP_000379645.1.89145 WP_000379645.1.89325 WP_000379645.1.89718 WP_000379645.1.90254 WP_000379645.1.90352 WP_000379645.1.90452 WP_000379645.1.90665 WP_000379645.1.91020 WP_000379645.1.92555 WP_000379645.1.93683 WP_000379645.1.93838 WP_000379645.1.94308 WP_000379645.1.94914 WP_000379645.1.9533 WP_000379645.1.95576 WP_000379645.1.96272 WP_000379645.1.96287 WP_000379645.1.96437 WP_000379645.1.9700 WP_000379645.1.9703 WP_000379645.1.97082 WP_000379645.1.97262 WP_000379645.1.97561 WP_000379645.1.97670 WP_000379645.1.97816 WP_000379645.1.97821 WP_000379645.1.97830 WP_000379645.1.97842 WP_000379645.1.98315 WP_000379645.1.9860 WP_000379645.1.98604 WP_000379645.1.99212 WP_000379645.1.99636 gi|218900332|ref|YP_002448743.1| gi|558684026|ref|YP_008822155.1| 226900.BC5215 405531.BCG9842_B5625 gi|449092272|ref|YP_007424713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]