SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC37666 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC37666
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.09e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC37666
Sequence length 110
Comment $ MCSG $ SQ211565 $ PDBT72843 $
Sequence
MEQMKITNLTGEQISFQLILHSGNARSCIIQSLRAYKEGKKDEADALIAKAEQDLSAAHD
IHFQMIQKESGGEATAFSLLLMHAEDHLMSTLSMKELVKEMLDLFKTKNI
Download sequence
Identical sequences APC37666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]