SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC61988 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC61988
Domain Number 1 Region: 34-285
Classification Level Classification E-value
Superfamily SPOC domain-like 6.67e-53
Family Ku80 subunit middle domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC61988
Sequence length 286
Comment $ MCSG $ SQ172884 $ PDBT83832 $
Sequence
MFLHDTYLILIFVFKFIMLMEKSVFYRARLRLSMRATWKGSISFGLVNIPVKVYKATTQK
EIQFHLLHSADGGRIRYRKVCEKCGKEVSDGEIVKGYEISKNEYVILTDEDFEKIPLKST
KSIEIRQFFDPAELGLIYYSSFYYISPDKGGEKAYYLLKKAMEETNSMGIGKMTMRGKEN
LVALRPYDGGIVLAQLHYIDEVRSPLELPGWGAVAEITEEELELAKKLILAMKKPLKLEE
FRDEYKEALMQLIEAKLSGREIVVSEGVEEVKSLIDALKASLEAVK
Download sequence
Identical sequences APC61988 224325.AF1726 WP_010879222.1.27515 WP_010879222.1.34637 WP_010879222.1.46508 gi|11499315|ref|NP_070554.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]