SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC62023 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC62023
Domain Number 1 Region: 18-277
Classification Level Classification E-value
Superfamily SPOC domain-like 7.06e-57
Family Ku80 subunit middle domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC62023
Sequence length 311
Comment $ MCSG $ SQ172966 $ PDBT83929 $
Sequence
MNRTPSLHTKEKKGFIDMHTMWKGSISFGLVNIPIKLYAATEDKDIKLRSLHKEDHAPIK
YEKVCTNCEKTLSPDEIVKGYEYVKGKYVVLTDEDLKSLKQEHEEKAVEIVDFVQLQEID
PIYFNRSYFVGPGDNGTKAYTLLREALRSTGKIGIANMTIRSKQQLAILRVYENCIVMES
IHYPDEVRSAAQVPGVPDQSNVNDKELQTAITLIDELTAKFEPEKYEDTYRQALLQRVND
KLENKETAVTPDKAPPREDVIDLVSALQASIDRTRRPNRETPAAAPAQAAEPKGAGDKKQ
KTTRKKASGTS
Download sequence
Identical sequences O34859
224308.BSU13410 NP_389224.1.22788 WP_010886496.1.11231 WP_010886496.1.11257 WP_010886496.1.1140 WP_010886496.1.11581 WP_010886496.1.12759 WP_010886496.1.15902 WP_010886496.1.16291 WP_010886496.1.18944 WP_010886496.1.19261 WP_010886496.1.20099 WP_010886496.1.27372 WP_010886496.1.27660 WP_010886496.1.2914 WP_010886496.1.31100 WP_010886496.1.32219 WP_010886496.1.32420 WP_010886496.1.33846 WP_010886496.1.36189 WP_010886496.1.39605 WP_010886496.1.40859 WP_010886496.1.44140 WP_010886496.1.44184 WP_010886496.1.45019 WP_010886496.1.47157 WP_010886496.1.56274 WP_010886496.1.56411 WP_010886496.1.57201 WP_010886496.1.5726 WP_010886496.1.57513 WP_010886496.1.6139 WP_010886496.1.6517 WP_010886496.1.65188 WP_010886496.1.65223 WP_010886496.1.7186 WP_010886496.1.72516 WP_010886496.1.72999 WP_010886496.1.76977 WP_010886496.1.78686 WP_010886496.1.79046 WP_010886496.1.80832 WP_010886496.1.81116 WP_010886496.1.81747 WP_010886496.1.82722 WP_010886496.1.88042 WP_010886496.1.91723 WP_010886496.1.93420 WP_010886496.1.94199 WP_010886496.1.96043 WP_010886496.1.979 gi|430756977|ref|YP_007209959.1| APC62023 gi|470161514|ref|YP_007533289.1| gi|16078406|ref|NP_389224.1| gi|402775577|ref|YP_006629521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]