SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC63528 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC63528
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily SPOC domain-like 2.94e-54
Family Ku80 subunit middle domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC63528
Sequence length 299
Comment $ MCSG $ SQ176425 $ PDBT87764 $
Sequence
MARAIWKGAISFGLVHIPVALVSATTSNSVDFDWLDKRSMDPVGYKRINKVTGKEVTKEN
IVKGVLHEKDRYVVLSEEEIRSAHPKSTQTIDIFAFVDSQQIPLQNIDTPYFLTPDKRGE
KVYALLRETLVDTQKVALANVVLHTREHLAAVMPLESALVMVILRWPADVRELDALELTE
AVTDARLTKSERDMARRLVKDMSADWQPDQYHDTFQEKIMQLVQTKAGEGKIEDVETDPG
EEERKSADVIDLTDLLRRSLAGKSSASKTRKPAAKDKVADKQSPKPKRPAVRKKTGKAS
Download sequence
Identical sequences Q87ZG4
223283.PSPTO_3465 APC63528 NP_793245.1.37326 WP_011104573.1.14276 WP_011104573.1.17870 WP_011104573.1.6959 gi|28870626|ref|NP_793245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]