SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC64616 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC64616
Domain Number 1 Region: 3-267
Classification Level Classification E-value
Superfamily SPOC domain-like 6.47e-44
Family Ku80 subunit middle domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC64616
Sequence length 308
Comment $ MCSG $ SQ179052 $ PDBT90600 $
Sequence
MMARIVWKGAIAFGLVHVPIVVHAASRPSRLDFDWIDRRDNAPVGYQRINKRTGRAIDGE
HIVKGYEYEKGEYVYMNDEDFARANVAATQTVEILDFVKAEEVPLYYFDTPYYLAPDRRG
GPGYALLHRALRDSGRIGIAQVVLHTRQHLAAVMPVGEVLMLVTMRYADEIVPAEEFGLD
DAATHDRPGARELRMAMRLLDDMTCKWDPAQYRDAYRDDLLAAIDRKVRAGKTHELAEPG
EAAPRASAKVIDLAAMLQQSLERGKRRAGAPAPPAKKAAPARKATAKGAAAKRARKTPAR
RAPARKAA
Download sequence
Identical sequences A0A0C6P2Y9 A0A0H3LWC3
APC64616 257310.BB2844 gi|412337974|ref|YP_006966729.1| gi|33601820|ref|NP_889380.1| WP_010926655.1.15674 WP_010926655.1.17334 WP_010926655.1.20111 WP_010926655.1.24339 WP_010926655.1.27032 WP_010926655.1.29688 WP_010926655.1.30681 WP_010926655.1.37794 WP_010926655.1.40806 WP_010926655.1.54628 WP_010926655.1.57255 WP_010926655.1.63299 WP_010926655.1.69310 WP_010926655.1.71104 WP_010926655.1.71382 WP_010926655.1.71489 WP_010926655.1.72199 WP_010926655.1.72302 WP_010926655.1.78117 WP_010926655.1.82663 WP_010926655.1.84976 WP_010926655.1.86585 WP_010926655.1.87218 WP_010926655.1.88542 WP_010926655.1.91389 WP_010926655.1.93987 YP_006966729.1.84680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]