SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC64740 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC64740
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.71e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC64740
Sequence length 141
Comment $ MCSG $ SQ179352 $ PDBT90930 $
Sequence
MDRLPILKLGDCLLVTIQVELHDRLALTLQDDLTTMIANTGARGVLIDISALDIVDSFIA
RVLGNIAAMSRVLGAETMVVGMQPAVAITLVELGVTWQHMHTALSVERGLERLKVLIAER
HTLRGHSPRGKRGGGVDGSRH
Download sequence
Identical sequences Q9RZT8
gi|10957446|ref|NP_051566.1| 243230.DR_B0025 APC64740 gi|10957446|ref|NP_051566.1|NC_000958 NP_051566.1.55610 WP_010883996.1.45201 WP_010883996.1.61927 WP_010883996.1.86829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]