SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC64863 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC64863
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily SPOC domain-like 3.14e-52
Family Ku80 subunit middle domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC64863
Sequence length 293
Comment $ MCSG $ SQ179652 $ PDBT91274 $
Sequence
MARAIWKGAISFGLVHIPVSLSAATSSQGIDFDWLDQRSMEPVGYKRVNKVTGKEIEREN
IVKGVEYEKGRYVVLSEEEIRAAHPKSTQTIEIFAFVDSQEIPLQHFDTPYYLVPDRRGG
KVYALLRETLERTGKVALANVVLHTRQHLALLRPLQDALVLITLRWPSQVRSLDGLELDE
SVTEAKLDKRELEMAKRLVEDMASHWEPDEYKDSFSDKIMKLVEEKAAKGQLHAVEEEEE
VAGKGADIIDLTDLLKRSLRSRAGGGKDKGSEKAGADAKGRAKSGASRSRRKA
Download sequence
Identical sequences Q9I1W5
gi|15597346|ref|NP_250840.1| 208964.PA2150 APC64863 NP_250840.1.87394 WP_003113644.1.101712 WP_003113644.1.16895 WP_003113644.1.18653 WP_003113644.1.21767 WP_003113644.1.23611 WP_003113644.1.24101 WP_003113644.1.24879 WP_003113644.1.26489 WP_003113644.1.2652 WP_003113644.1.2948 WP_003113644.1.31852 WP_003113644.1.35480 WP_003113644.1.36521 WP_003113644.1.37208 WP_003113644.1.3785 WP_003113644.1.3792 WP_003113644.1.41502 WP_003113644.1.41773 WP_003113644.1.41871 WP_003113644.1.42643 WP_003113644.1.43802 WP_003113644.1.47527 WP_003113644.1.48413 WP_003113644.1.49286 WP_003113644.1.50653 WP_003113644.1.50967 WP_003113644.1.53530 WP_003113644.1.55347 WP_003113644.1.62357 WP_003113644.1.63057 WP_003113644.1.65066 WP_003113644.1.65740 WP_003113644.1.68857 WP_003113644.1.71806 WP_003113644.1.73455 WP_003113644.1.80938 WP_003113644.1.81771 WP_003113644.1.83131 WP_003113644.1.84715 WP_003113644.1.84754 WP_003113644.1.9182 WP_003113644.1.91862 WP_003113644.1.92175 WP_003113644.1.92357 WP_003113644.1.92585 WP_003113644.1.95025 WP_003113644.1.98600 WP_003113644.1.99293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]