SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC64937 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC64937
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily SPOC domain-like 4.51e-54
Family Ku80 subunit middle domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC64937
Sequence length 273
Comment $ MCSG $ SQ179832 $ PDBT91484 $
Sequence
MARAIWKGAISFGLVHIPVALNTAVRTERVDFDWLDKRSMEPVGYKRVNKVTGKEIDKDN
IVKGVEFEKGRYVVISEEEIRKARPETTQTIDIFSFVEAGDIPLQHFDTPYYLTPDRRGG
KVYALLRETLEKTGKVALATVVLHTRQHLALLRPLDHALVMITLRWPEEVRGLETLELDA
SVTDSKVEKRELEMAKRLVEDMSGPWKPEDYHDAFRQTIMDLVEEKASKGKIEAVEKGDT
GAAEKGADILDLTELLKRSLGGKKPVKKTRKAS
Download sequence
Identical sequences Q88HU8
160488.PP_3255 APC64937 gi|26989973|ref|NP_745398.1| NP_745398.1.35174 WP_010954137.1.3142 WP_010954137.1.58218 WP_010954137.1.71439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]