SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65115 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65115
Domain Number 1 Region: 3-264
Classification Level Classification E-value
Superfamily SPOC domain-like 3.73e-54
Family Ku80 subunit middle domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC65115
Sequence length 298
Comment $ MCSG $ SQ180269 $ PDBT91989 $
Sequence
MERMRSIWKGSIAFGLVNVPVKVYSATEDHDIRFHQVHAKDGGRIKYNRVCSECGNVVQY
ADIDKAYDSDDGVRVVLTDDDFGKLPAAEKHEIPVLQFVPTEQIDPILFEKSYFLEPDSS
SPKAYVLLATALENSDRTALVHFTLRQRTRLAAMRSRDGVLVIQTLLWPDEVRVAEFSSL
DGVDKPKAKELAMAETLVDSMADDFDPTEFTDDYQVQLRELLDEMIESGGKKVIPVAEVE
KSGEDAEVVDLVAALQRSVDAAGKKAAPAKKKPAKKAPAKTAAKKATAKSSSSERKRA
Download sequence
Identical sequences J1R6G5 Q0S0H0
APC65115 gi|111024152|ref|YP_707124.1| WP_009480467.1.53434 WP_009480467.1.60566 WP_009480467.1.78234 101510.RHA1_ro07202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]