SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65175 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65175
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily SPOC domain-like 7.06e-53
Family Ku80 subunit middle domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC65175
Sequence length 293
Comment $ MCSG $ SQ180417 $ PDBT92146 $
Sequence
MPRAYWKGTLKLSLVTCPVALYPATTSVEKTRFHMINAETGNRLKQQMIDEDTGDVVEKD
QKARGYEVRKGKYIEIEKDELEAVQIESTHTIDIDSFVPADEIDQRFLNHPYYIVPDGKA
GTDAFAVIRDAMKDKGHVALGRIVLTNREHVLAIEPFGKGLLATTLRYPYELRDADEYFD
GIKSPKISKDMVELAGHILETKAAHFEPKKFKDEYETALKALVKRKAAGKSIKLPEPEEK
ESNVVSLMDALKQSLEGGKSGSKTGKAHGRRKASRSSARTKARRSTARQRKAG
Download sequence
Identical sequences Q6N3P2
gi|39936713|ref|NP_948989.1| APC65175 258594.RPA3651 WP_011159190.1.60452 WP_011159190.1.81860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]