SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65176.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65176.2
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily SPOC domain-like 4.51e-39
Family Ku70 subunit middle domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC65176.2
Sequence length 147
Comment $ MCSG $ SQ180423 $ PDBT92152 $
Sequence
PRANWKGFLRLSLVTCPVALYPATSDSDKISFNQINRATGHRIKYLKVDAETGDEVPVDE
IMKGYKVDTDSYIEITKDELDNLALESTRTIEIDQFVPRAEIDDLYLVRPYYLVPDGKVG
HDAYAVIRETIRSMDKVALARVVLTNR
Download sequence
Identical sequences APC65176.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]