SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65361 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65361
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily SPOC domain-like 7.85e-45
Family Ku80 subunit middle domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC65361
Sequence length 294
Comment $ MCSG $ SQ180872 $ PDBT92657 $
Sequence
MAPRASWKGYIRLSLVSCPVRLYPATSASERISFNQLHKDTHNRINMKPVDPELGLVERS
DLVKGYEYEDKKYIIIEDSDLESVRIESNHTMNIEAFVDAGSVDVIYQDAPYYLAPDGAM
AEETFVVLREALRRSGKLAIARLVLSSRERVVTIGPRETGMFVCTLRNPNEVRGTADYFG
NIPVGKPDPEMLQLAEALIEQKTTTFDPKQYEDRYEVALMQMIREKLKGHKPIIAQAPER
GNVVNLMDALKASLSQAKPPARSKPKAEPAAKEPAAKAAAAKRVTAKPAAKKKA
Download sequence
Identical sequences A0A0E0URN2 A0A222JHF8 H0FUW6 Q92TV2
gi|16265141|ref|NP_437933.1| APC65361 gi|16265141|ref|NP_437933.1|NC_003078 gi|384534260|ref|YP_005716924.1|NC_017323 gi|433610486|ref|YP_007193947.1|NC_019849 gi|470186778|ref|YP_007614150.1|NC_020560 gi|470186778|ref|YP_007614150.1| NP_437933.1.96377 WP_003526412.1.18618 WP_003526412.1.21755 WP_003526412.1.22199 WP_003526412.1.24285 WP_003526412.1.32135 WP_003526412.1.36091 WP_003526412.1.36292 WP_003526412.1.36834 WP_003526412.1.4234 WP_003526412.1.44594 WP_003526412.1.47143 WP_003526412.1.49828 WP_003526412.1.58221 WP_003526412.1.58608 WP_003526412.1.63001 WP_003526412.1.65778 WP_003526412.1.66997 WP_003526412.1.72343 WP_003526412.1.73540 WP_003526412.1.78492 WP_003526412.1.787 WP_003526412.1.79107 WP_003526412.1.80755 WP_003526412.1.83536 WP_003526412.1.86220 WP_003526412.1.89614 WP_003526412.1.90561 WP_003526412.1.90968 WP_003526412.1.92524 WP_003526412.1.94084 gi|334320279|ref|YP_004556908.1| gi|433610486|ref|YP_007193947.1| gi|384534260|ref|YP_005716924.1| 266834.SM_b20686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]