SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65362 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65362
Domain Number 1 Region: 6-262
Classification Level Classification E-value
Superfamily SPOC domain-like 9.42e-51
Family Ku70 subunit middle domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC65362
Sequence length 294
Comment $ MCSG $ SQ180876 $ PDBT92661 $
Sequence
MAVSARAQWKGYLRFGEVTAPVALYTATSTSDRIAFHTVNRETGNRVRREFIDSVSGKPV
EKEDQVKGYEIGDERYVVLEPEEVASAVPESDKTLRVQAFIPCDEVEKVYFDKPYYLTPD
KMGTDAFALLREGMRKKKVAAIAQTVLFRRMRTILLRPHDKGLIATTLNFDYEVRSAKEA
FKEIPDIKIEGEMLDLAKHIIGMKKGTFSAEEFDDRYEAALADLIKAKLEGKSLPKRAPP
KVSKANDLLEALRQSAGMKKPPAASKKRAGKESAAKTKAKTAAKSAPAQRRRAS
Download sequence
Identical sequences A0A0E0US57 A0A222IG14 Q92UA3
APC65362 NP_437773.1.96377 WP_010976056.1.18618 WP_010976056.1.22199 WP_010976056.1.36834 WP_010976056.1.4234 WP_010976056.1.47143 WP_010976056.1.49828 WP_010976056.1.58221 WP_010976056.1.58608 WP_010976056.1.63001 WP_010976056.1.65778 WP_010976056.1.66997 WP_010976056.1.72343 WP_010976056.1.73540 WP_010976056.1.78492 WP_010976056.1.787 WP_010976056.1.79107 WP_010976056.1.80755 WP_010976056.1.86220 WP_010976056.1.89614 WP_010976056.1.90561 WP_010976056.1.90968 WP_010976056.1.92524 WP_010976056.1.94084 gi|470186616|ref|YP_007613988.1| gi|433610638|ref|YP_007194099.1| gi|16264981|ref|NP_437773.1|NC_003078 gi|384534410|ref|YP_005717074.1|NC_017323 gi|433610638|ref|YP_007194099.1|NC_019849 gi|470186616|ref|YP_007613988.1|NC_020560 gi|384534410|ref|YP_005717074.1| gi|16264981|ref|NP_437773.1| 266834.SM_b21406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]