SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65363 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65363
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily SPOC domain-like 1.35e-46
Family Ku70 subunit middle domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC65363
Sequence length 272
Comment $ MCSG $ SQ180880 $ PDBT92665 $
Sequence
MAPPRPYWKGYLKLSLVTCPVSMMPATSESEKVRFHTLNRKSNNRVVSRYVDAVTGKEVD
EDDEVKGYERGENDFLVIEDEELESVALESARTIDIEKFVPRDTIEWIWLEKPHYLTPSD
EVGHEAFSVIRDAMVAEKVAGISRLVIGRRERAVMLEPCGKGIVVWTLRYGDEVRKPENY
FADIGDGDNDPKLMSLVTSLIEERSKPWNPNMVSDPVQEKLLEIIESKRKSAKKVAKPKA
KEGEPVHAGNVIDLMAALKGSLEKKKPGGKKS
Download sequence
Identical sequences A0A0E0URE8 A0A222KGJ5 F7XJM7 Q92UA2
APC65363 gi|470186617|ref|YP_007613989.1| gi|16264982|ref|NP_437774.1| 266834.SM_b21407 gi|384538622|ref|YP_005722706.1| NP_437774.1.96377 WP_010976057.1.18618 WP_010976057.1.21755 WP_010976057.1.30341 WP_010976057.1.3038 WP_010976057.1.3110 WP_010976057.1.34728 WP_010976057.1.36091 WP_010976057.1.36292 WP_010976057.1.36834 WP_010976057.1.4234 WP_010976057.1.44594 WP_010976057.1.47143 WP_010976057.1.48083 WP_010976057.1.49828 WP_010976057.1.50755 WP_010976057.1.58221 WP_010976057.1.63001 WP_010976057.1.65778 WP_010976057.1.787 WP_010976057.1.80755 WP_010976057.1.83096 WP_010976057.1.83536 WP_010976057.1.86220 WP_010976057.1.89614 WP_010976057.1.90968 WP_010976057.1.92524 WP_010976057.1.94084 WP_010976057.1.96031 WP_010976057.1.99158 gi|407723067|ref|YP_006842728.1| gi|334320417|ref|YP_004557046.1| gi|384534409|ref|YP_005717073.1| gi|433610637|ref|YP_007194098.1| gi|16264982|ref|NP_437774.1|NC_003078 gi|384534409|ref|YP_005717073.1|NC_017323 gi|384538622|ref|YP_005722706.1|NC_017326 gi|407723067|ref|YP_006842728.1|NC_018701 gi|433610637|ref|YP_007194098.1|NC_019849 gi|470186617|ref|YP_007613989.1|NC_020560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]