SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65364 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65364
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily SPOC domain-like 6.87e-48
Family Ku80 subunit middle domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC65364
Sequence length 268
Comment $ MCSG $ SQ180883 $ PDBT92668 $
Sequence
MALRPYWKGYLKLSLVTCPVQMMPATSESEKVRFHTLNRQTQNRVVSHYVDSVTGKEVKE
EDEVKGYQRGEHEYVILEDEELENVALESTKTIDISTFTPRDSIEWIWLDTPYCLSPNDP
VGQEAFSVIRDAMEAQNMVGISRLVISRRERAVMLEPRGKGIVLWTLRYGDEVRDEDSYF
EAIGDEQADSEMMPLVQQLIKKQTKDWTPKMVADPVQERLLEIIAAKKKALKPQKAQGKT
APSSSPSNVVSIMDALRKSVAAEKRATK
Download sequence
Identical sequences Q930H1
266834.SMa0426 APC65364 gi|16262678|ref|NP_435471.1| gi|16262678|ref|NP_435471.1|NC_003037 gi|470184212|ref|YP_007572185.1|NC_020527 NP_435471.1.96377 WP_010967224.1.4234 WP_010967224.1.787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]