SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65549 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65549
Domain Number 1 Region: 17-127
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.33e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC65549
Sequence length 143
Comment $ MCSG $ SQ181352 $ PDBT93164 $
Sequence
MSQAFPGPHGAPATGHVPVLRLGEVLLVTLQGDLHDSTAQQLQEDLAETIVRSGATGVVI
DVSGVEIVDSFLGRILAEIAGQTGLLAARTVLVGMRPAVAITLVELGLTLPGVHTALSTE
VAMELLRQQAPSSRFGGLRQESQ
Download sequence
Identical sequences Q9KY15
NP_631377.1.49638 WP_003971818.1.26049 WP_003971818.1.30910 WP_003971818.1.43399 WP_003971818.1.55229 WP_003971818.1.58943 WP_003971818.1.86682 100226.SCO7323 gi|21225598|ref|NP_631377.1| APC65549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]