SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC88399 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC88399
Domain Number 1 Region: 10-342
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.04e-49
Family AAT-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC88399
Sequence length 345
Comment $ MCSG $ SQ128522 $ PDBT110562 $
Sequence
MQWLTFQWLEFIREYREKAKHNLSNSGMPEPDLKSLGIDTSYEHYLDAAGEVEYRFTEAL
SRRLRVDQDLIIPTVGGTEAIFIALSHLSSVSKRIHVPLPEYEPMFLVPESLGIETSKIE
SKVMPGRISKNESIAMTLPNNPTAQYSDRISLLDNVIHSEGLIYIDETFRDFLPSGTRPT
LFDGSETMVVSGTMTKFYGLSNLRTGWIISSEHNVAGMRRIKDLTSINNASFSLYIAAQA
IQKWNYFKEAEDNLINKNLRVAREYLEGLPGISYKEPEGAPFIFLSYSKNIESVKLAKLA
VERYGILFAPGSFFGEEHHIRVCLTSNKPEEDFNVLKEFLKKEAV
Download sequence
Identical sequences Q97BG0
gi|13541327|ref|NP_111015.1| 375716 APC88399 273116.TVN0496 WP_010916754.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]