SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BdR36 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BdR36
Domain Number 1 Region: 91-394
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-56
Family Tandem AAA-ATPase domain 0.00013
Further Details:      
 
Domain Number 2 Region: 592-668
Classification Level Classification E-value
Superfamily HRDC-like 1.42e-23
Family HRDC domain from helicases 0.001
Further Details:      
 
Domain Number 3 Region: 467-567
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.67e-17
Family RecQ helicase DNA-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BdR36
Sequence length 674
Comment $ NESG $ SQ225009 $ PDBT166878 $
Sequence
MGKTRAGRFALRGQRTALLHLETMTQAVDSADSVDPRALEALNRYFGYDSFRPGQSGIVS
AILTGHDVLGVMPTGAGKSICYQIPAAILPGVAIVISPLISLMRDQVDALNDVGLPAAFI
NTTQTPDEQDLVFAQALSGQIKLLYVAPERLETERFRNFAVRVPISLVAVDEAHCVSQWG
QDFRSSYLGIGEFIAGLPTRPTVAAFTATATERVRRDIVSILGLHTPSITVTGFDRPNLY
FDVISMPRKDKASWVASYIASHPDESGIVYCATRKETEALAESLNSAVAELRAAGGADVS
DIGTIAVAYHGGMSADAREKAQRDFVTDRVPVVVATNAFGMGIDKSNVRFVIHHNMPESI
EAYYQEAGRAGRDGEPSRCTLLWNESDIVTRRRLLDSDYENERLTPEEQEAVRASKRRLL
DAMVGYCRTTDCLHAYMTRYFGETAGAAAKTDGKCVGGCANCEHTFETIDVTDIARAISR
CVHDVNQHVGSGKIVKVLRGSKAQDLSYLNPESLPSFGMLDEVPEARIRDVLSQMATDGF
LTIAEGRLPIVGFGPRAAETVAPEFHYDIKKIKRADARARRTPDVSTPAVGSYVPDDGDE
ALFQKLRALRLDIARELGKPPYIVFSDKTLRDMVRVKPITDDQFLAVNGVGESKLKQYGE
RFLAAIREDSGDEA
Download sequence
Identical sequences A1A0P0
WP_011742945.1.36503 WP_011742945.1.64668 gi|119025510|ref|YP_909355.1| 367928.BAD_0492 BdR36

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]