SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BdR43 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BdR43
Domain Number 1 Region: 23-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.54e-71
Family Protein kinases, catalytic subunit 0.00000846
Further Details:      
 
Weak hits

Sequence:  BdR43
Domain Number - Region: 592-648
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000968
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BdR43
Sequence length 732
Comment $ NESG $ SQ226050 $ PDBT167969 $
Sequence
MKKESYRLAMSEAQHAPEGQVIEGRYRVVSRIADGGMATVYQAVDERLGRTVAIKIMHTQ
LAQGPQRDQFVERFHREARSAAAIANPHIVQVYDTGEFDGLDFLVMEYVHGVNLRYEMNQ
QVTFSVRETLRIVGETLDGLASAHRAGVVHRDIKPENILLNDRGHVQITDFGLAKAVSQA
TLSSTGMLLGTAAYLAPEMIQHNQATPQGDLYSVGIMAWEMLAGKVPFTADNPVTLVFKH
VHEDVPDITTACPGINAGVAAFLARLTARAVEDRPQDASVAFDELQQLQSNLTIDDWQYR
LSAVSPAANDAADTMPGDGTRQMPLPPAPPAPPVRQNDDRTRQFNPENPNKTTVMPAQQA
DPEATTRLALEKNDVPANNVPASPSNGPVSGGQPKRSGKRAPVIIAVVAAIVLACAGGGG
YAWWYFRGPGSYWTMPQPADLTCSDSEPCRISNIKWNAYEELLKFSNIEYEETEAFSDSV
KAGNVISTDPENVGSHVSKRHHQKVKVVVSKGIKQGTVPTDILDATSANGKDPINALKRA
GFDNIEQTPANDDAYSMDVPQGALLDLSVDPGATLPHNAKITVTLSQGPKPVTMPDVVGK
SKDEAQQTLDALKLTVNWTEQFDDKIPQGQVISASAKTGDELHWGDSVNAVVSKGPETVT
LPNYVGQKAAAAKAALEKLGFSVKISSQLTLDSSQDKKVASQDPVGGTEVRLRQEDGTPN
TVTLKMYSSLFD
Download sequence
Identical sequences A1A262
BdR43 367928.BAD_1014 gi|119026032|ref|YP_909877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]