SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C30G4.3 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C30G4.3
Domain Number 1 Region: 833-1023
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.15e-54
Family Adenylyl and guanylyl cyclase catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 503-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.27e-37
Family Protein kinases, catalytic subunit 0.00072
Further Details:      
 
Domain Number 3 Region: 56-369
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000553
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C30G4.3
Sequence length 1057
Comment $ SECSG $ SQ45649 $ PDBT11270 $
Sequence
MLDIMLADTKKNDGLLGVVGVENDCKEIAALAQAYDASSLLVNCEDQVGESQMPSSTALQ
MSSTQGGKYRAFAKLAKSVGWNNLAVINFVEDGPADISYHDQLLDALSAESISLDFVKKG
GFSSTITSAMFTGLESVIDVILETYMKTRIYVIVLDLPVSGTFFMNAMSTMGLLETGKYF
VVMMSSIESDAANYFGFNVNRDFSDEWTSFQKRVDGDASKTFCPPMCNTKAKGIANNDPW
SDDAYWYSESPSIVDAYDLGRLLSETVKVHGASLLRDPESLVQTMSGRGVTSLLGYVTKF
NTNGVSQREYILWAPQQASSSNGPIPLPEWATLAARMLPDGKGNYSIIWKNLTQLGIFNG
ELPQSKPECGFNNELCPAGIPESEPSSFFDFSKNLYLKKRVVLKWIAYERRLESSYFLVH
RKHVQLVDMTKFGSSRGGSMIQSAMSMRSQYEDSGPVGGATMNFYTNGIRKAAIRRNQMQ
RSDKGPAANRDEWLEIVDWHLAKYENTLVTVRKINKTQLKLTREMKQEIDLLMNETHENL
NRFFGLINESDLIFTIHSYGPRKSLMDLLRNDDLRLDRMFKVSFVEDVVKGLQFLHEGSK
IGYHGNLKSSNCIVDAYWRIKLSNYGMEQIRVEEPESKPDVFYDLVIFSNKYNSKTKNPI
KKFSTDLLWFAPEIIRRYAVKHDLSKLELAKADIYSLAIVLYEIYGRQGPFGDDLLDSDE
IIEQLKFPDGGALTRPDIHLITKAPYPLASVVEKCWVEDPASRPSIQKVRELLEPLSKGL
KGNIADNIMNLLDRYRNNLEDVIKERTEQLEDERKRNESLLLQLLPKSVANSLKNGQPVD
AEFYDSVSIYFSDIVGFTALSSKSTPLQVVNMLNNLYTNFDTIIDKFDCYKVETIGDAYM
FVSGLPEVNSYLHAGEVASASLELLDSIKTFTVSHCPDEKLRLRIGNHTGPVVTGVVGIR
MPRYCLFGDTVIIANMMESSGEPMRIQISSDAYELILKCGGYVTEQREKIVLKNKLEVMT
YWMNDYSKDARLARLVAHQEKFPHLEHLIHKFNKGVR
Download sequence
Identical sequences C30G4.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]