SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CsR146 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CsR146
Domain Number 1 Region: 3-179,273-387
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CsR146
Sequence length 401
Comment $ NESG $ SQ141730 $ PDBT143290 $
Sequence
MEHFDCVVIGGGMVGAASALTLAQLGLKVALVEKFTPQAFSAEQPLDLRVSAISLASQNL
LNQVGAWQQVKQWRSCPYKRLGVWEYESAYTEFNADDIEQSHLGHIVENRLIQLALWQQV
TAMSNIHTYCPESLLSLNQDDDSGNNRATLTLTNSVVTAKLVIGADGAQSKVRQMSAIGM
TGWDYQQSAMLINVETSMCQQDITWQKFSPTGPVAFLPLPGQSPLGGYASLVWYHQRDEI
TRLASLSNSQLQQEVLKCFPAQLGDIKVLAKGDFSLTRRHANTYQHKRVLLLGDAAHTIN
PMAGQGVNLGFKDVLALQHVIAEAIGNGEAWHDEAVLVRYEKMRRKDNLLMMSTMDALYA
GFSHPSPLIKAARNLALLAVNKVPVLNSTIKNKALAYACGL
Download sequence
Identical sequences Q47Y84
167879.CPS_3568 WP_011044322.1.15195 gi|71280762|ref|YP_270236.1| CsR146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]