SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CsR91 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CsR91
Domain Number 1 Region: 5-66,97-261
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.4e-50
Family GidA-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CsR91
Sequence length 629
Comment $ NESG $ SQ98800 $ PDBT134407 $
Sequence
MWYQESYDVIVVGGGHAGTEASLAAARMGCKTLLLTHNIDTLGQMSCNPAIGGIGKGHLV
KEIDALGGLMATAIDHSAIQFRTLNSSKGPAVRATRAQADRILYRNYVRNTLENQENLTI
FQQPCDDLILENDRVVGVSTQMGLKFKGKSVVLTVGTFLSGLIHIGLNNYQGGRAGDPAS
VNLAAKMRDMPFRMDRLKTGTPPRLDARSLDFSVMEEQAGDTPSPVFSFMGSQADHPEQI
SCFITHTNEQTHQHIRDGLDRSPMYTGVIEGVGPRYCPSIEDKITRFADKSSHQIFVEPE
GLTTHEVYPNGISTSLPFDVQMNLVRSIKGFENAFITRPGYAIEYDYFDPRDLKQSLESK
FVQNLYFAGQINGTTGYEEAGAQGLIAGANAANRVKERDEFTLGRDQAYMGVLIDDLATL
GTKEPYRMFTSRAEYRLLLREDNADIRLTEQGRKIGLVGDTRWQRFNEKMENVELERQRL
RSTWVQKDHTKIDQINALLKTPMSKEASLEDLIRRPEVNYTDLMKIEGLGPAIEDSQASE
QIEIQTKYAGYIDRQLDEIAKKKRNEDTKIPRDFDYQQISGLSNEVVAKLKDACPETIGK
ASRISGITPAAISLLLVYLKKHGLLRKLA
Download sequence
Identical sequences Q47U38
CsR91 167879.CPS_5047 WP_011045765.1.15195 gi|71279490|ref|YP_271685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]