SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FR722 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FR722
Domain Number 1 Region: 165-289
Classification Level Classification E-value
Superfamily TPR-like 1.9e-22
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 
Domain Number 2 Region: 10-91,124-149
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-16
Family FKBP immunophilin/proline isomerase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) FR722
Sequence length 320
Comment $ NESG $ SQ151146 $ PDBT149364 $
Sequence
MQSRSKSDMKPIRKEILNPGNAYIELTPGTRVKFHFQTRRAGDSRIIDDSRKMEKPMELV
LGKKFKLEVWELIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKPEERRHCCGMTL
QNEGIGYTDLDELLQNPSDLEFIIELFSIELPEQYEKERWQMSDDEKMLATSTLRERGNN
FYKASRFTEAETCYREAVGIVEQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFY
AVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKS
IEDQQQARNVQDRIHMQKLF
Download sequence
Identical sequences Q9VYT2
FBpp0073411 FBpp0073411 NP_572758.1.81976 FR722 FBpp0073411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]