SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.102531 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.102531
Domain Number 1 Region: 254-533
Classification Level Classification E-value
Superfamily SPOC domain-like 6.04e-86
Family Ku70 subunit middle domain 0.000000000136
Further Details:      
 
Domain Number 2 Region: 34-253
Classification Level Classification E-value
Superfamily vWA-like 8.74e-62
Family Ku70 subunit N-terminal domain 0.00000000242
Further Details:      
 
Domain Number 3 Region: 560-608
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000527
Family SAP domain 0.0000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.102531
Sequence length 609
Comment $ CESG $ SQ78050 $ PDBT208672 $
Sequence
MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPF
DMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELD
QFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDS
AKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKT
RTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHH
YLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEEL
DDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKV
TKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL
EALTKHFQD
Download sequence
Identical sequences A0A024R1N4 G2HER7 P12956
ENSP00000352257 ENSP00000353192 ENSP00000384257 gi|4503841|ref|NP_001460.1| NP_001267434.1.37143 NP_001275905.1.87134 NP_001275905.1.92137 NP_001460.1.87134 NP_001460.1.92137 XP_016794760.1.37143 XP_016794761.1.37143 XP_016794762.1.37143 XP_016802713.1.37143 XP_016802714.1.37143 ENSP00000352257 ENSP00000353192 ENSP00000384257 1jeyA GO.102531 9606.ENSP00000352257 1jeq_A 1jey_A ENSP00000352257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]