SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.16487 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.16487
Domain Number 1 Region: 136-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-17
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.16487
Sequence length 250
Comment $ CESG $ SQ3562 $ PDBT209061 $
Sequence
MANSTGKPTSSTQEDEEATSATEILAQLMQDIIDREEDIDDEDDIDDEVIDDEDYEVASL
PLLQESQANQKQSREREEETEKNQPKRFKKQNMMKINIHDFSEETLRLIEVWYEAELDPQ
DIFGDNEVTRLFSRPIKKQLMSSDVDKDQCMLMLSKEQVKEKMLPFLEDSENPVKGIDVS
VYGPDGKVQQMEFKMWNGDKTPVLTSGWKQFVEDYGLSMTCDFVTVWMFRHIKTRKLCFA
IHYVKFSLRD
Download sequence
Identical sequences Q9ZR14
NP_192226.1.80155 AT4G03170.1 3702.AT4G03170.1-P GO.16487 AT4G03170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]