SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.30189 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GO.30189
Domain Number - Region: 189-228,269-420
Classification Level Classification E-value
Superfamily TPR-like 0.0111
Family CT2138-like 0.089
Further Details:      
 
Domain Number - Region: 133-176,234-320
Classification Level Classification E-value
Superfamily TPR-like 0.0186
Family Tetratricopeptide repeat (TPR) 0.072
Further Details:      
 
Domain Number - Region: 48-76
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0844
Family PHD domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.30189
Sequence length 435
Comment $ CESG $ SQ4836 $ PDBT208363 $
Sequence
MGSTGSCHEDIRTRDACGSVMPLKSLKRTKDSQPEELLCKYCSKLRKSNQYCGICKRIWH
PPDDRDWVCCDGCNVWDGFMLNATTLRMSALSVVHVGQGSSHQVNGKGIQAAEPKSGSLV
LIKGPTKQSFVGYDEAISLFDYFFNESQTLPNMLSCNLIIKAHCDQGSVDHALELYRHIL
LDGSLAPGIETYRILTKALVGAKRLDEACDVVRSMSRCDFAVYDILIRGFLDKGKFVRAS
QIFEELKGPNSKLPWRNYHKAIAIFNVSFMDYWFKQGKDEEAMEIFATLEHAELLNTISG
NGVLKCLVEHGRKTEAWELFLDMIEICDSETVGIIMSKEGFFGEKTIPFERVRRTCYTRM
IASLCQQGNMLEAEKLFADMFADVDGDDLLAGPDVSTFRAMINGYVKVGRVDDAIKTLNK
MKISNLRKLSIHQAT
Download sequence
Identical sequences Q303Z7
AT5G28340.1 AR2911 GO.30189 NP_198186.3.80155 3702.AT5G28340.1-P AT5G28340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]