SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.36692 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.36692
Domain Number 1 Region: 3-269
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.83e-54
Family ADP-ribosylglycohydrolase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.36692
Sequence length 272
Comment $ CESG $ SQ6693 $ PDBT210006 $
Sequence
MVRCYVEIVEKLPERRPDPATIEGCAQLKPNNYLLAWHTPFNEKGSGFGAATKAMCIGLR
YWKPERLETLIEVSVECGRMTHNHPTGFLGSLCTALFVSFAAQGKPLVQWGRDMLRAVPL
AEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKAIFPDNYDAEEREKTYRK
WSSEGRGGRRGHDAPMIAYDALLAAGNSWTELCHRAMFHGGESAATGTIAGCLFGLLYGL
DLVPKGLYQDLEDKEKLEDLGAALYRLSTEEK
Download sequence
Identical sequences NP_954631.1.87134 NP_954631.1.92137 ENSP00000348894 ENSP00000348894 gi|40316946|ref|NP_954631.1| GO.36692 HR2229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]