SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.4647 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.4647
Domain Number 1 Region: 203-317
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000706
Family B3 DNA binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.4647
Sequence length 333
Comment $ CESG $ SQ1660 $ PDBT208200 $
Sequence
MSTYYNDHLAAAEKDISSSNFCNLVDASVMLYDEEHRDLLPKKVNSRCQAKTKKQEKESD
KRFFDLFPKKRRTSVVTVRNPEQNQQNLHRVSTSSSLLDLNTIPGDSSDPRNELQGLLSS
SSSSFLGDYERKTPQNASSSSTLLAEYNTEMANPPNPNSETSLKRKHSDSEPKKAKTPYS
WKGREAPEWLVKMMGTMQGSEGPRLIYEKTLTETDVKPVQSRLLMPFNTLIRNDFLTPVE
LRILLELEDDTDGVGATLVDPWEVKWGVILKKREMKKYSGKGSLNYAIICGWNDIVEANV
LEKDDDISIWSFRRGRNGILSFALVLPPPPDMA
Download sequence
Identical sequences Q9C6X0
NP_174483.1.80155 AT1G32030.1 3702.AT1G32030.1-P GO.4647 AT1G32030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]