SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9121 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9121
Domain Number 1 Region: 434-524
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.9121
Sequence length 539
Comment $ NYCOMPS $ SQ227726 $ PDBT340642 $
Sequence
MLRFSGRFEGYSLKRFQKDIVAGMVVGVVAIPLGMAFAIASGVKPEHGLYTVIVAGILIS
LLGGSKYQIGGPTGAFVPILFAIVLQYGFENLLIAGFMAGVILVILGLLKLGKIIKFIPR
PVIIGFTAGIAVIIFTGEIAKFLGLRNVEKHESFYMNMREVVINLNTLSFYSILTAVVSL
FFVLFTPKVLPKVPGALAGLLVSTVMATMLFPEQVVTIGSAYGEIPRSLPSFQFPELSLE
KIIYLMPPALAIAMLGGIESLLSAMVADNMKGTRHDSNKELVGQGIANIAAPLFGGIPAT
GAIARTATNIKTGAASPISGIVHGVFVLLVLLLFAPYASLIPLASMSPILMVVAWNMSER
KEFINILKIRNSDSAVLVVTFLLTVWQDLVFGVAAGILLAIITFIARMSKSFRIKKDVSE
SIVQSAAAAEEKHFQRSVSIYSVEGPLFFGSSNSLEDSILDKGHPPKLLILLMNKVDYMD
SSAEGSLMTIVNRVHQQNGKVMIVGLQQQPRELLHKTGLFHKIGKKHFVDRPEQIFDVT
Download sequence
Identical sequences A0A1Y0YW18 Q65EI1 T5HK89
gi|52082010|ref|YP_080801.1| WP_009329635.1.1290 WP_009329635.1.20727 WP_009329635.1.22930 WP_009329635.1.27377 WP_009329635.1.27836 WP_009329635.1.30581 WP_009329635.1.31877 WP_009329635.1.34504 WP_009329635.1.34956 WP_009329635.1.35726 WP_009329635.1.42641 WP_009329635.1.47006 WP_009329635.1.50447 WP_009329635.1.54544 WP_009329635.1.55910 WP_009329635.1.62441 WP_009329635.1.62618 WP_009329635.1.70162 WP_009329635.1.719 WP_009329635.1.7403 WP_009329635.1.74244 WP_009329635.1.8120 WP_009329635.1.86740 WP_009329635.1.9500 WP_009329635.1.95031 WP_009329635.1.9558 WP_009329635.1.96953 WP_009329635.1.98374 WP_009329635.1.99505 279010.BL03425 gi|404490890|ref|YP_006714996.1| GO.9121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]