SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HR3230 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3230
Domain Number 1 Region: 6-76
Classification Level Classification E-value
Superfamily E set domains 0.0000196
Family Filamin repeat (rod domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR3230
Sequence length 409
Comment $ NESG $ SQ99036 $ PDBT134655 $
Sequence
MVELFIFLFLLGETPFKVVVKSLSPKELVRIHVPKPLDRNDGTFLMRYRMYETVDEGLKI
EVLYGDEHVAQSPYILKGPVYHEYCECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQ
QMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGKYTDFKMFSDEILLSLTRKVLLPDLEF
YVNLGDWPLEHRKVNGTPSPIPIISWCGSLDSRDVVLPTYDITHSMLEAMRGVTNDLLSI
QGNTGPSWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKEKELGKA
KLMGFFDFFKYKYQVNVDGTVAAYRYPYLMLGDSLVLKQDSPYYEHFYMALEPWKHYVPI
KRNLSDLLEKVKWAKSFTLSPRLECSGTISTHCNLCLPGSRNFVPQPPE
Download sequence
Identical sequences A0A2J8L0M2
HR3230 ENSP00000431796 ENSP00000364799 ENSP00000431796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]