SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IDP00458 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IDP00458
Domain Number 1 Region: 16-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.44e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) IDP00458
Sequence length 115
Comment $ CSGID $ SQ190209 $ PDBT348759 $
Sequence
MFDLSSIVDNEQTSDALEDVVMGLIINAGQARSLAYNALKQAKAGDFAQADELMAQSRSA
LNDAHLVQTQLIEADQGEGKTKVTLVLVHAQDHLMNAMLARELITELIELHQKIQ
Download sequence
Identical sequences A0A0E1NSK3 A0A0H2YFN2 A0A0H3B2R7 A0A0M1V2Q5 A0A0U1EVD3 A0A208S7V5 A0A2A7VIA9 Q0WDL0 Q667R2 Q7CJS0
gi|22125153|ref|NP_668576.1| gi|384139485|ref|YP_005522187.1| gi|384415609|ref|YP_005624971.1| gi|170023392|ref|YP_001719897.1| gi|45442265|ref|NP_993804.1| gi|51597245|ref|YP_071436.1| gi|384126797|ref|YP_005509411.1| gi|186896347|ref|YP_001873459.1| gi|108808403|ref|YP_652319.1| gi|145598876|ref|YP_001162952.1| gi|384122938|ref|YP_005505558.1| gi|218929753|ref|YP_002347628.1| APC7956 IDP00458 gi|294504474|ref|YP_003568536.1| 187410.y1253 214092.YPO2680 229193.YP_2482 273123.YPTB2929 360102.YPA_2409 377628.YPN_1166 386656.YPDSF_1594 502800.YPK_1146 502801.YPTS_3045 WP_002212242.1.100083 WP_002212242.1.100246 WP_002212242.1.10066 WP_002212242.1.100921 WP_002212242.1.100931 WP_002212242.1.10105 WP_002212242.1.101305 WP_002212242.1.101382 WP_002212242.1.101928 WP_002212242.1.102067 WP_002212242.1.10736 WP_002212242.1.10935 WP_002212242.1.10955 WP_002212242.1.11693 WP_002212242.1.12463 WP_002212242.1.12736 WP_002212242.1.12857 WP_002212242.1.1388 WP_002212242.1.14063 WP_002212242.1.14804 WP_002212242.1.15321 WP_002212242.1.15555 WP_002212242.1.15605 WP_002212242.1.15689 WP_002212242.1.16243 WP_002212242.1.16333 WP_002212242.1.17135 WP_002212242.1.17141 WP_002212242.1.17608 WP_002212242.1.17873 WP_002212242.1.17983 WP_002212242.1.18208 WP_002212242.1.18640 WP_002212242.1.18826 WP_002212242.1.19329 WP_002212242.1.19425 WP_002212242.1.19739 WP_002212242.1.19763 WP_002212242.1.20035 WP_002212242.1.20547 WP_002212242.1.2064 WP_002212242.1.20932 WP_002212242.1.21486 WP_002212242.1.21784 WP_002212242.1.21879 WP_002212242.1.21934 WP_002212242.1.22530 WP_002212242.1.22542 WP_002212242.1.22708 WP_002212242.1.23157 WP_002212242.1.23271 WP_002212242.1.23687 WP_002212242.1.23811 WP_002212242.1.24002 WP_002212242.1.2451 WP_002212242.1.24517 WP_002212242.1.25181 WP_002212242.1.25394 WP_002212242.1.26383 WP_002212242.1.2640 WP_002212242.1.26776 WP_002212242.1.26960 WP_002212242.1.27124 WP_002212242.1.27251 WP_002212242.1.2726 WP_002212242.1.28647 WP_002212242.1.28922 WP_002212242.1.29157 WP_002212242.1.29355 WP_002212242.1.2947 WP_002212242.1.29622 WP_002212242.1.2964 WP_002212242.1.29685 WP_002212242.1.29814 WP_002212242.1.3092 WP_002212242.1.30931 WP_002212242.1.311 WP_002212242.1.31336 WP_002212242.1.31496 WP_002212242.1.31739 WP_002212242.1.31805 WP_002212242.1.32343 WP_002212242.1.32388 WP_002212242.1.32446 WP_002212242.1.32736 WP_002212242.1.33203 WP_002212242.1.33324 WP_002212242.1.33661 WP_002212242.1.33937 WP_002212242.1.34031 WP_002212242.1.34138 WP_002212242.1.35389 WP_002212242.1.35538 WP_002212242.1.36088 WP_002212242.1.37174 WP_002212242.1.37494 WP_002212242.1.37863 WP_002212242.1.38147 WP_002212242.1.38235 WP_002212242.1.38743 WP_002212242.1.38824 WP_002212242.1.38993 WP_002212242.1.39066 WP_002212242.1.39346 WP_002212242.1.3976 WP_002212242.1.40071 WP_002212242.1.40134 WP_002212242.1.40534 WP_002212242.1.40853 WP_002212242.1.41196 WP_002212242.1.42490 WP_002212242.1.42976 WP_002212242.1.44408 WP_002212242.1.44598 WP_002212242.1.44603 WP_002212242.1.44832 WP_002212242.1.45198 WP_002212242.1.45214 WP_002212242.1.46262 WP_002212242.1.46545 WP_002212242.1.46686 WP_002212242.1.46697 WP_002212242.1.46731 WP_002212242.1.4678 WP_002212242.1.46891 WP_002212242.1.47387 WP_002212242.1.47440 WP_002212242.1.47881 WP_002212242.1.48166 WP_002212242.1.48722 WP_002212242.1.4889 WP_002212242.1.49315 WP_002212242.1.49906 WP_002212242.1.4997 WP_002212242.1.50010 WP_002212242.1.50093 WP_002212242.1.50106 WP_002212242.1.50185 WP_002212242.1.50984 WP_002212242.1.51284 WP_002212242.1.51293 WP_002212242.1.51588 WP_002212242.1.51772 WP_002212242.1.51934 WP_002212242.1.52158 WP_002212242.1.52247 WP_002212242.1.52473 WP_002212242.1.52734 WP_002212242.1.52792 WP_002212242.1.52819 WP_002212242.1.52969 WP_002212242.1.53147 WP_002212242.1.53300 WP_002212242.1.53838 WP_002212242.1.53848 WP_002212242.1.53883 WP_002212242.1.53953 WP_002212242.1.54568 WP_002212242.1.54951 WP_002212242.1.55194 WP_002212242.1.55695 WP_002212242.1.5592 WP_002212242.1.56031 WP_002212242.1.56912 WP_002212242.1.56953 WP_002212242.1.57585 WP_002212242.1.57657 WP_002212242.1.58067 WP_002212242.1.58794 WP_002212242.1.59102 WP_002212242.1.59431 WP_002212242.1.5957 WP_002212242.1.59635 WP_002212242.1.59687 WP_002212242.1.59789 WP_002212242.1.59885 WP_002212242.1.60437 WP_002212242.1.60707 WP_002212242.1.60896 WP_002212242.1.61689 WP_002212242.1.62232 WP_002212242.1.62342 WP_002212242.1.6270 WP_002212242.1.63387 WP_002212242.1.63641 WP_002212242.1.64142 WP_002212242.1.64474 WP_002212242.1.64780 WP_002212242.1.64786 WP_002212242.1.64910 WP_002212242.1.653 WP_002212242.1.65400 WP_002212242.1.65554 WP_002212242.1.6570 WP_002212242.1.65718 WP_002212242.1.6581 WP_002212242.1.66118 WP_002212242.1.66546 WP_002212242.1.66616 WP_002212242.1.67404 WP_002212242.1.67850 WP_002212242.1.6791 WP_002212242.1.68361 WP_002212242.1.68855 WP_002212242.1.69018 WP_002212242.1.69316 WP_002212242.1.69951 WP_002212242.1.70117 WP_002212242.1.70171 WP_002212242.1.70319 WP_002212242.1.70377 WP_002212242.1.70417 WP_002212242.1.70726 WP_002212242.1.7083 WP_002212242.1.7169 WP_002212242.1.71744 WP_002212242.1.72280 WP_002212242.1.72440 WP_002212242.1.72486 WP_002212242.1.7402 WP_002212242.1.74131 WP_002212242.1.74310 WP_002212242.1.74577 WP_002212242.1.74738 WP_002212242.1.75173 WP_002212242.1.7518 WP_002212242.1.75208 WP_002212242.1.75337 WP_002212242.1.75407 WP_002212242.1.75636 WP_002212242.1.75689 WP_002212242.1.75821 WP_002212242.1.76670 WP_002212242.1.77387 WP_002212242.1.77429 WP_002212242.1.77691 WP_002212242.1.78004 WP_002212242.1.7841 WP_002212242.1.78556 WP_002212242.1.79515 WP_002212242.1.79550 WP_002212242.1.79609 WP_002212242.1.79981 WP_002212242.1.8009 WP_002212242.1.80331 WP_002212242.1.81848 WP_002212242.1.81877 WP_002212242.1.8210 WP_002212242.1.82133 WP_002212242.1.82151 WP_002212242.1.82270 WP_002212242.1.82619 WP_002212242.1.8303 WP_002212242.1.83039 WP_002212242.1.83265 WP_002212242.1.8420 WP_002212242.1.84703 WP_002212242.1.84720 WP_002212242.1.85269 WP_002212242.1.85270 WP_002212242.1.8559 WP_002212242.1.85802 WP_002212242.1.86034 WP_002212242.1.86059 WP_002212242.1.86413 WP_002212242.1.87107 WP_002212242.1.8728 WP_002212242.1.87418 WP_002212242.1.8762 WP_002212242.1.87853 WP_002212242.1.87988 WP_002212242.1.88362 WP_002212242.1.88472 WP_002212242.1.89359 WP_002212242.1.8964 WP_002212242.1.90176 WP_002212242.1.9051 WP_002212242.1.90624 WP_002212242.1.91373 WP_002212242.1.91844 WP_002212242.1.92030 WP_002212242.1.92331 WP_002212242.1.92604 WP_002212242.1.927 WP_002212242.1.9311 WP_002212242.1.9320 WP_002212242.1.93623 WP_002212242.1.93928 WP_002212242.1.93933 WP_002212242.1.94052 WP_002212242.1.94201 WP_002212242.1.94545 WP_002212242.1.94683 WP_002212242.1.95746 WP_002212242.1.95981 WP_002212242.1.97245 WP_002212242.1.97375 WP_002212242.1.97448 WP_002212242.1.97791 WP_002212242.1.97864 WP_002212242.1.97872 WP_002212242.1.97894 WP_002212242.1.99109 WP_002212242.1.99383 WP_002212242.1.9941 WP_002212242.1.99416 WP_002212242.1.99788 WP_002212242.1.99882 WP_002212242.1.99990 YP_002347628.1.25044 gi|108811329|ref|YP_647096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]