SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IDP01100 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IDP01100
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.07e-37
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) IDP01100
Sequence length 107
Comment $ CSGID $ SQ190803 $ PDBT349370 $
Sequence
MMTTAEQIPFQLILNSGNARSFAMEALQFAKQGKMAEADEAMVKAKEAINEAHHFQTELI
QSEARGEKTEISVLLIHAQDHLMNAITVKELAAEFIDLYKKLEAKGE
Download sequence
Identical sequences A0A0B5NZ49 A0A0D0RHW3 A0A0D0RLP6 A0A0F5RSG7 A0A0G8CSC0 A0A0K6MP30 A0A0T8VJC4 A0A154B242 A0A1C9C1J5 A0A1E8BG55 A0A1I4KWL1 A0A1J9ZBU0 A0A1K0ADW2 A0A1K0BBL7 A0A1M7CYW9 A0A1Q4M9Z1 A0A1S9BM44 A0A1V9VYS1 A0A1X3MLH8 A0A229MBD5 A0A242W4C9 A0A242WL76 A0A242Y9D7 A0A242ZE25 A0A243B6K4 A0A243CLS2 A0A243F837 A0A243FN23 A0A243GVA6 A0A243KBD6 A0A243KH91 A0A243MTW5 A0A246UFL7 A0A2A8GMH5 A0A2A8V0F6 A0A2A9HSH2 A0A2B8UWE5 A0A2C9Z789 A0A2D0AVR9 A0A2G6QF71 A0A2K1RZN3 A0RKZ5 B3Z8S5 B3ZR20 B7HX38 B9J5L1 C2MT94 C2PMU3 C2QJS3 C2SBL7 C2TP95 C2ULJ6 C2W1L3 C2YZ34 C3GAR7 C3GRJ1 D8H2T6 F0PT45 J8DU84 J8K7F5 J8WQR4 K0FWV2 Q6HB80 Q81X08 R8E5U1 R8FA85 R8G4T5 R8G869 R8JYW7 R8L5E6 S3I909
gi|222098663|ref|YP_002532721.1| 198094.BA_5442 260799.BAS5057 261594.GBAA5442 281309.BT9727_4887 361100.BCQ_5032 405534.BCAH187_A5374 412694.BALH_4702 568206.BAMEG_5492 592021.BAA_5470 gi|227817967|ref|YP_002817976.1| gi|384183070|ref|YP_005568832.1| gi|49188043|ref|YP_031296.1| gi|229603956|ref|YP_002869427.1| gi|49481178|ref|YP_039196.1| gi|47530756|ref|YP_022105.1| gi|407707678|ref|YP_006831263.1| gi|301056669|ref|YP_003794880.1| gi|375287219|ref|YP_005107658.1| gi|30265233|ref|NP_847610.1| IDP01100 gi|376269105|ref|YP_005121817.1| gi|118480244|ref|YP_897395.1| gi|217962690|ref|YP_002341264.1| gi|557621948|ref|YP_008783079.1| gi|386739062|ref|YP_006212243.1| NP_847610.1.87267 WP_000989050.1.100059 WP_000989050.1.100095 WP_000989050.1.100214 WP_000989050.1.100241 WP_000989050.1.100409 WP_000989050.1.100595 WP_000989050.1.100873 WP_000989050.1.101140 WP_000989050.1.101843 WP_000989050.1.101931 WP_000989050.1.10208 WP_000989050.1.10762 WP_000989050.1.11380 WP_000989050.1.11387 WP_000989050.1.11427 WP_000989050.1.11521 WP_000989050.1.11676 WP_000989050.1.12289 WP_000989050.1.12751 WP_000989050.1.13024 WP_000989050.1.13113 WP_000989050.1.13115 WP_000989050.1.13233 WP_000989050.1.13279 WP_000989050.1.13299 WP_000989050.1.13820 WP_000989050.1.13975 WP_000989050.1.14084 WP_000989050.1.14721 WP_000989050.1.14855 WP_000989050.1.14882 WP_000989050.1.15460 WP_000989050.1.15569 WP_000989050.1.16013 WP_000989050.1.16156 WP_000989050.1.16170 WP_000989050.1.16199 WP_000989050.1.16997 WP_000989050.1.17146 WP_000989050.1.17265 WP_000989050.1.17408 WP_000989050.1.17424 WP_000989050.1.17797 WP_000989050.1.17927 WP_000989050.1.1809 WP_000989050.1.1850 WP_000989050.1.18840 WP_000989050.1.18976 WP_000989050.1.1907 WP_000989050.1.19258 WP_000989050.1.19435 WP_000989050.1.19445 WP_000989050.1.195 WP_000989050.1.20390 WP_000989050.1.20643 WP_000989050.1.20665 WP_000989050.1.20680 WP_000989050.1.20687 WP_000989050.1.20865 WP_000989050.1.21021 WP_000989050.1.21258 WP_000989050.1.21643 WP_000989050.1.21776 WP_000989050.1.22152 WP_000989050.1.22865 WP_000989050.1.23100 WP_000989050.1.23110 WP_000989050.1.23269 WP_000989050.1.23297 WP_000989050.1.23615 WP_000989050.1.24184 WP_000989050.1.2419 WP_000989050.1.24334 WP_000989050.1.24377 WP_000989050.1.24556 WP_000989050.1.24608 WP_000989050.1.24792 WP_000989050.1.24969 WP_000989050.1.24992 WP_000989050.1.25316 WP_000989050.1.25505 WP_000989050.1.25572 WP_000989050.1.25716 WP_000989050.1.25752 WP_000989050.1.25757 WP_000989050.1.26000 WP_000989050.1.2618 WP_000989050.1.26450 WP_000989050.1.26499 WP_000989050.1.26665 WP_000989050.1.26721 WP_000989050.1.26847 WP_000989050.1.27138 WP_000989050.1.27140 WP_000989050.1.27334 WP_000989050.1.27644 WP_000989050.1.27987 WP_000989050.1.28427 WP_000989050.1.28729 WP_000989050.1.29101 WP_000989050.1.29209 WP_000989050.1.29787 WP_000989050.1.29804 WP_000989050.1.30091 WP_000989050.1.30110 WP_000989050.1.30144 WP_000989050.1.30216 WP_000989050.1.3130 WP_000989050.1.31387 WP_000989050.1.31490 WP_000989050.1.31685 WP_000989050.1.3196 WP_000989050.1.3236 WP_000989050.1.32522 WP_000989050.1.32576 WP_000989050.1.33045 WP_000989050.1.33061 WP_000989050.1.33175 WP_000989050.1.3318 WP_000989050.1.33338 WP_000989050.1.33367 WP_000989050.1.33740 WP_000989050.1.33828 WP_000989050.1.33876 WP_000989050.1.34061 WP_000989050.1.34125 WP_000989050.1.34646 WP_000989050.1.35255 WP_000989050.1.35518 WP_000989050.1.3561 WP_000989050.1.35684 WP_000989050.1.35886 WP_000989050.1.3615 WP_000989050.1.36305 WP_000989050.1.36763 WP_000989050.1.3699 WP_000989050.1.37093 WP_000989050.1.37626 WP_000989050.1.37661 WP_000989050.1.37990 WP_000989050.1.38036 WP_000989050.1.38517 WP_000989050.1.39538 WP_000989050.1.39781 WP_000989050.1.40550 WP_000989050.1.40839 WP_000989050.1.41083 WP_000989050.1.41090 WP_000989050.1.41165 WP_000989050.1.41365 WP_000989050.1.41675 WP_000989050.1.42165 WP_000989050.1.42182 WP_000989050.1.42217 WP_000989050.1.43104 WP_000989050.1.43533 WP_000989050.1.43762 WP_000989050.1.4439 WP_000989050.1.44463 WP_000989050.1.45089 WP_000989050.1.45305 WP_000989050.1.45385 WP_000989050.1.45533 WP_000989050.1.45919 WP_000989050.1.46236 WP_000989050.1.46349 WP_000989050.1.46476 WP_000989050.1.4649 WP_000989050.1.46524 WP_000989050.1.46549 WP_000989050.1.46586 WP_000989050.1.46699 WP_000989050.1.46746 WP_000989050.1.47097 WP_000989050.1.47145 WP_000989050.1.473 WP_000989050.1.47441 WP_000989050.1.4763 WP_000989050.1.47644 WP_000989050.1.47798 WP_000989050.1.48164 WP_000989050.1.48311 WP_000989050.1.48599 WP_000989050.1.4865 WP_000989050.1.49428 WP_000989050.1.49831 WP_000989050.1.499 WP_000989050.1.50316 WP_000989050.1.50487 WP_000989050.1.50514 WP_000989050.1.51087 WP_000989050.1.51099 WP_000989050.1.51167 WP_000989050.1.51556 WP_000989050.1.51749 WP_000989050.1.52532 WP_000989050.1.52756 WP_000989050.1.52794 WP_000989050.1.52932 WP_000989050.1.53137 WP_000989050.1.53493 WP_000989050.1.53683 WP_000989050.1.53879 WP_000989050.1.54117 WP_000989050.1.54189 WP_000989050.1.54419 WP_000989050.1.54547 WP_000989050.1.54775 WP_000989050.1.54782 WP_000989050.1.55057 WP_000989050.1.55811 WP_000989050.1.55958 WP_000989050.1.55968 WP_000989050.1.56042 WP_000989050.1.56055 WP_000989050.1.56176 WP_000989050.1.56270 WP_000989050.1.5628 WP_000989050.1.56318 WP_000989050.1.56580 WP_000989050.1.56959 WP_000989050.1.57203 WP_000989050.1.57245 WP_000989050.1.57565 WP_000989050.1.57815 WP_000989050.1.57859 WP_000989050.1.58160 WP_000989050.1.58328 WP_000989050.1.58335 WP_000989050.1.5841 WP_000989050.1.58814 WP_000989050.1.59075 WP_000989050.1.59095 WP_000989050.1.59173 WP_000989050.1.59310 WP_000989050.1.59575 WP_000989050.1.59773 WP_000989050.1.59978 WP_000989050.1.60255 WP_000989050.1.60274 WP_000989050.1.60402 WP_000989050.1.60841 WP_000989050.1.61213 WP_000989050.1.61231 WP_000989050.1.61481 WP_000989050.1.62300 WP_000989050.1.62978 WP_000989050.1.63137 WP_000989050.1.63560 WP_000989050.1.63611 WP_000989050.1.64377 WP_000989050.1.64491 WP_000989050.1.64666 WP_000989050.1.64770 WP_000989050.1.66331 WP_000989050.1.66357 WP_000989050.1.66535 WP_000989050.1.67239 WP_000989050.1.67283 WP_000989050.1.68607 WP_000989050.1.69203 WP_000989050.1.69347 WP_000989050.1.69703 WP_000989050.1.69822 WP_000989050.1.69894 WP_000989050.1.69970 WP_000989050.1.70065 WP_000989050.1.70108 WP_000989050.1.70645 WP_000989050.1.7096 WP_000989050.1.70996 WP_000989050.1.71648 WP_000989050.1.71895 WP_000989050.1.71953 WP_000989050.1.72514 WP_000989050.1.72554 WP_000989050.1.72704 WP_000989050.1.72912 WP_000989050.1.73325 WP_000989050.1.73329 WP_000989050.1.74226 WP_000989050.1.74302 WP_000989050.1.74538 WP_000989050.1.7534 WP_000989050.1.75374 WP_000989050.1.75499 WP_000989050.1.75554 WP_000989050.1.75870 WP_000989050.1.75891 WP_000989050.1.75942 WP_000989050.1.76125 WP_000989050.1.76783 WP_000989050.1.77370 WP_000989050.1.77576 WP_000989050.1.77668 WP_000989050.1.77690 WP_000989050.1.77824 WP_000989050.1.77968 WP_000989050.1.78264 WP_000989050.1.7856 WP_000989050.1.78644 WP_000989050.1.79250 WP_000989050.1.79252 WP_000989050.1.79315 WP_000989050.1.79549 WP_000989050.1.79584 WP_000989050.1.79658 WP_000989050.1.80239 WP_000989050.1.80439 WP_000989050.1.80695 WP_000989050.1.80955 WP_000989050.1.80964 WP_000989050.1.81088 WP_000989050.1.81198 WP_000989050.1.81799 WP_000989050.1.82289 WP_000989050.1.82421 WP_000989050.1.82533 WP_000989050.1.82566 WP_000989050.1.82986 WP_000989050.1.83070 WP_000989050.1.8365 WP_000989050.1.83938 WP_000989050.1.83951 WP_000989050.1.84045 WP_000989050.1.84337 WP_000989050.1.84614 WP_000989050.1.85667 WP_000989050.1.85689 WP_000989050.1.85901 WP_000989050.1.86041 WP_000989050.1.86119 WP_000989050.1.86140 WP_000989050.1.86239 WP_000989050.1.86288 WP_000989050.1.8698 WP_000989050.1.87627 WP_000989050.1.8825 WP_000989050.1.88641 WP_000989050.1.8907 WP_000989050.1.8923 WP_000989050.1.89675 WP_000989050.1.89698 WP_000989050.1.89704 WP_000989050.1.89932 WP_000989050.1.90155 WP_000989050.1.90187 WP_000989050.1.90452 WP_000989050.1.90596 WP_000989050.1.90791 WP_000989050.1.90883 WP_000989050.1.91367 WP_000989050.1.91404 WP_000989050.1.91615 WP_000989050.1.9186 WP_000989050.1.92686 WP_000989050.1.9269 WP_000989050.1.92831 WP_000989050.1.93271 WP_000989050.1.93290 WP_000989050.1.93744 WP_000989050.1.93838 WP_000989050.1.93893 WP_000989050.1.93904 WP_000989050.1.93927 WP_000989050.1.93932 WP_000989050.1.94322 WP_000989050.1.94373 WP_000989050.1.94784 WP_000989050.1.94914 WP_000989050.1.9533 WP_000989050.1.95457 WP_000989050.1.95484 WP_000989050.1.95786 WP_000989050.1.96272 WP_000989050.1.96356 WP_000989050.1.96934 WP_000989050.1.97149 WP_000989050.1.97781 WP_000989050.1.97861 WP_000989050.1.98216 WP_000989050.1.98519 WP_000989050.1.98604 WP_000989050.1.99266 WP_000989050.1.99445 WP_000989050.1.99454 WP_000989050.1.99485 WP_000989050.1.99994 YP_031296.1.16718 YP_039196.1.62562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]