SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IDP02298 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IDP02298
Domain Number 1 Region: 855-964
Classification Level Classification E-value
Superfamily Collagen-binding domain 3.92e-31
Family Collagen-binding domain 0.0000983
Further Details:      
 
Domain Number 2 Region: 745-850
Classification Level Classification E-value
Superfamily PKD domain 2.49e-18
Family PKD domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) IDP02298
Sequence length 965
Comment $ CSGID $ SQ191803 $ PDBT350447 $
Sequence
MNKKSKINKVMLSISTMALSLGAIQTHVSAEEKVPYNVLHSKPVGIEKPVDEIGHVSKAE
ETLSFQERLKVGDFSQRPASITNKVTVKQVKESYSMADLNKMNNQELVETLGSIKWHQIT
DLFQFNEDAKAFYKDKGKMQVVIDELAHRGSTFTKDDSKGIQTFTEVLRSAFYLAFYNNE
LSELNERSFQDKCLPALKAIAKNPNFKLGTTEQDTVVSAYGKLISNASSDVETVQYASNI
LKQYNDNFTTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARKEANETMWYGKVDGFINEIN
RIALLNEVTQENKWLVNNGIYFASRLGKFHSNPNKGLEVVTQAMHMYPRLSEPYFVAVEQ
ITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGSIVFKTGDKVSEEKIKRLYWAA
KEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGRGDMYQNERLTWFQEGNAEFFA
GSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKYGSWDFYNYSFALQSYLYTHQFETF
DKIQDLIRANDVKNYDAYRENLSKDLKLNEEYQEYMQHLIDNQDKYNVPEVADDYLAEHT
PKSLTAVEKEITETLPMKDAKMTKHSSQFFNTFTLEGTYTGSVTKGDSEDWNAMSKKVNE
ALEQLAQKEWSGYKTVTAYFVNYGVNSSNQFEYDVVFHGIAKDDEENKAPTVNINGPYNG
LVKEGIQFKSDGSKDEDGKIVSYLWDFGDGSTSAEVNPVHVYESEGSYKVALIVKDDKGK
ESKSEITVTVKGGSLTESEPNNRPEEANRIGLNTTIKGSLIGGDHTDVYTFNVASAKNID
ISVLNEYGIGMTWVLHHESDMQNYAAYGQANGNHIEANFNAKPGKYYLYVYKYDNGDGTY
ELSVK
Download sequence
Identical sequences A0A0F7RMG0 Q81YS7
gi|229602058|ref|YP_002865158.1| IDP02298 gi|30260713|ref|NP_843090.1| NP_843090.1.87267 WP_001036378.1.100214 WP_001036378.1.100595 WP_001036378.1.10208 WP_001036378.1.11427 WP_001036378.1.11676 WP_001036378.1.13115 WP_001036378.1.13233 WP_001036378.1.13820 WP_001036378.1.14721 WP_001036378.1.14855 WP_001036378.1.15460 WP_001036378.1.15569 WP_001036378.1.16170 WP_001036378.1.16997 WP_001036378.1.17146 WP_001036378.1.18976 WP_001036378.1.19258 WP_001036378.1.19435 WP_001036378.1.19445 WP_001036378.1.20390 WP_001036378.1.20680 WP_001036378.1.21021 WP_001036378.1.21258 WP_001036378.1.21776 WP_001036378.1.22865 WP_001036378.1.23269 WP_001036378.1.2419 WP_001036378.1.24334 WP_001036378.1.24556 WP_001036378.1.24608 WP_001036378.1.25716 WP_001036378.1.25752 WP_001036378.1.2618 WP_001036378.1.26665 WP_001036378.1.26721 WP_001036378.1.27644 WP_001036378.1.27987 WP_001036378.1.28427 WP_001036378.1.28729 WP_001036378.1.29101 WP_001036378.1.29787 WP_001036378.1.30110 WP_001036378.1.31490 WP_001036378.1.3236 WP_001036378.1.32576 WP_001036378.1.33338 WP_001036378.1.33367 WP_001036378.1.33740 WP_001036378.1.34646 WP_001036378.1.35684 WP_001036378.1.35886 WP_001036378.1.36305 WP_001036378.1.36763 WP_001036378.1.38036 WP_001036378.1.39781 WP_001036378.1.40550 WP_001036378.1.41165 WP_001036378.1.4439 WP_001036378.1.45305 WP_001036378.1.45533 WP_001036378.1.46236 WP_001036378.1.46699 WP_001036378.1.47145 WP_001036378.1.4763 WP_001036378.1.47644 WP_001036378.1.47798 WP_001036378.1.51749 WP_001036378.1.52794 WP_001036378.1.53137 WP_001036378.1.53493 WP_001036378.1.53683 WP_001036378.1.54117 WP_001036378.1.54189 WP_001036378.1.55811 WP_001036378.1.55958 WP_001036378.1.56042 WP_001036378.1.56176 WP_001036378.1.56270 WP_001036378.1.56959 WP_001036378.1.58160 WP_001036378.1.59095 WP_001036378.1.59310 WP_001036378.1.59575 WP_001036378.1.60402 WP_001036378.1.61213 WP_001036378.1.63560 WP_001036378.1.68607 WP_001036378.1.69822 WP_001036378.1.69894 WP_001036378.1.70065 WP_001036378.1.70996 WP_001036378.1.72704 WP_001036378.1.73325 WP_001036378.1.74226 WP_001036378.1.74538 WP_001036378.1.75499 WP_001036378.1.75870 WP_001036378.1.76125 WP_001036378.1.76783 WP_001036378.1.77824 WP_001036378.1.78644 WP_001036378.1.79315 WP_001036378.1.79584 WP_001036378.1.80439 WP_001036378.1.80695 WP_001036378.1.81799 WP_001036378.1.82289 WP_001036378.1.83951 WP_001036378.1.84045 WP_001036378.1.86119 WP_001036378.1.86140 WP_001036378.1.86239 WP_001036378.1.86288 WP_001036378.1.8698 WP_001036378.1.8825 WP_001036378.1.88641 WP_001036378.1.90791 WP_001036378.1.90883 WP_001036378.1.9186 WP_001036378.1.92686 WP_001036378.1.92831 WP_001036378.1.93271 WP_001036378.1.93744 WP_001036378.1.93927 WP_001036378.1.94237 WP_001036378.1.94322 WP_001036378.1.94784 WP_001036378.1.96934 WP_001036378.1.97781 WP_001036378.1.97861 WP_001036378.1.98216 WP_001036378.1.99445 WP_001036378.1.99485 YP_026801.1.16718 198094.BA_0555 260799.BAS0523 261594.GBAA0555 568206.BAMEG_4031 592021.BAA_0637 gi|47525828|ref|YP_017177.1| gi|227816574|ref|YP_002816583.1| gi|49183549|ref|YP_026801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]