SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IDP02563 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IDP02563
Domain Number 1 Region: 857-959
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.31e-27
Family Collagen-binding domain 0.00022
Further Details:      
 
Domain Number 2 Region: 739-849
Classification Level Classification E-value
Superfamily PKD domain 6.8e-20
Family PKD domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) IDP02563
Sequence length 960
Comment $ CSGID $ SQ192057 $ PDBT350712 $
Sequence
MNKNLKFTQMMIGISTMALSFGSIQTHVSAEETASYNILQMKPIGTETSKDEIVHATKAD
ETLTFEERLKVGDFSQRPTLVMERDEIQLKQSYTLAELNKMPNSELIDTLSKISWNQITD
LFQFNQDTKAFYQNKERMNVIINELGQRGRTFTKENSKGIETFVEVLRSAFYVGYYNNEL
SYLKERSFHEKCLPALKAIAKNPNFTLGTAEQDRVVAAYGKLIGNASSDTETVQYAVNVL
KQYNDNLTTYVSDYAKGQAVYEIVKGIDYDIQSYLQDTNKQPNETMWYGKIDNFINEVNR
IALVGNITNENSWLINNGIYYAGRLGKFHSNPYKGLEVITQAMSLYPRLSGPYFVAVEQI
KTNYGGKDYSGKAVDLQKIREEGKRQYLPKTYTFDDGSIVFKTGDKVTEEKIKRLYWAAK
EVKAQYHRVIGNDKALEPGNADDVLTIVIYNNPDEYQLNRQLYGYETNNGGIYIEEKRTF
FTYERTPKQSIYSLEELFRHEFTHYLQGRYEVPGLFGSGEMYQNERLTWFQEGNAEFFAG
STRTNNVVPRKSMISGLSSDPASRYTAKQTLFSKYGSWDFYKYSFALQSYLYNHQFDTFD
KLQDLIRVNDVKNYDSYRESLSNNTQLNAEYQAYMQQLIDNQDKYNVPQVTNDYLIQHAP
KPLAEVKNEIVDVANIKDAKITKYESQFFNTFTVEGKYTGGTSKGESEDWKTMSKQVNRT
LEQLSQKGWSGYKTVTAYFVNYRVNAANQFEYDIVFHGVATEEKEKTNTIVNMNGPYSGI
VNEEIQFHSDGTKSENGKVTSYLWNFGDGTTSTEANPTHVYEEKGTYTVELTVKDRRGKE
SKEQTKVTVKQDPQTGEFHEEEKVLLFNTLVKGNLVTPDQTDVYTFDVTDTKEVDISVVN
EQNIGMTWVLYHESDMQNYVACGEDEGNVIKGKFEAKPGKYYLNVYKFDDKNGEYSLLVK
Download sequence
Identical sequences Q81NB3
gi|49186065|ref|YP_029317.1| gi|47528584|ref|YP_019933.1| NP_845590.1.87267 WP_001038978.1.100214 WP_001038978.1.100595 WP_001038978.1.10208 WP_001038978.1.11427 WP_001038978.1.11676 WP_001038978.1.13115 WP_001038978.1.13820 WP_001038978.1.14721 WP_001038978.1.14855 WP_001038978.1.15460 WP_001038978.1.15569 WP_001038978.1.16170 WP_001038978.1.16997 WP_001038978.1.17146 WP_001038978.1.18976 WP_001038978.1.19258 WP_001038978.1.19435 WP_001038978.1.19445 WP_001038978.1.20390 WP_001038978.1.20680 WP_001038978.1.21021 WP_001038978.1.21258 WP_001038978.1.21776 WP_001038978.1.22865 WP_001038978.1.23269 WP_001038978.1.2419 WP_001038978.1.24334 WP_001038978.1.24556 WP_001038978.1.24608 WP_001038978.1.25716 WP_001038978.1.25752 WP_001038978.1.2618 WP_001038978.1.26665 WP_001038978.1.26721 WP_001038978.1.27987 WP_001038978.1.28427 WP_001038978.1.28729 WP_001038978.1.29101 WP_001038978.1.29787 WP_001038978.1.30110 WP_001038978.1.31490 WP_001038978.1.3236 WP_001038978.1.32576 WP_001038978.1.33175 WP_001038978.1.33338 WP_001038978.1.33367 WP_001038978.1.33740 WP_001038978.1.33876 WP_001038978.1.34646 WP_001038978.1.35684 WP_001038978.1.35886 WP_001038978.1.36305 WP_001038978.1.36763 WP_001038978.1.38036 WP_001038978.1.39781 WP_001038978.1.41165 WP_001038978.1.41675 WP_001038978.1.4439 WP_001038978.1.45305 WP_001038978.1.45533 WP_001038978.1.46236 WP_001038978.1.46699 WP_001038978.1.4763 WP_001038978.1.47644 WP_001038978.1.51749 WP_001038978.1.52794 WP_001038978.1.53137 WP_001038978.1.53493 WP_001038978.1.53683 WP_001038978.1.54117 WP_001038978.1.54189 WP_001038978.1.55811 WP_001038978.1.55958 WP_001038978.1.56042 WP_001038978.1.56176 WP_001038978.1.56270 WP_001038978.1.58160 WP_001038978.1.59095 WP_001038978.1.59310 WP_001038978.1.59575 WP_001038978.1.60402 WP_001038978.1.61213 WP_001038978.1.63560 WP_001038978.1.68607 WP_001038978.1.69203 WP_001038978.1.69822 WP_001038978.1.69894 WP_001038978.1.70065 WP_001038978.1.70996 WP_001038978.1.72704 WP_001038978.1.73325 WP_001038978.1.74226 WP_001038978.1.74538 WP_001038978.1.75499 WP_001038978.1.75870 WP_001038978.1.76125 WP_001038978.1.76783 WP_001038978.1.77668 WP_001038978.1.77824 WP_001038978.1.78644 WP_001038978.1.79315 WP_001038978.1.79584 WP_001038978.1.80695 WP_001038978.1.81799 WP_001038978.1.82289 WP_001038978.1.83951 WP_001038978.1.84045 WP_001038978.1.85689 WP_001038978.1.86119 WP_001038978.1.86140 WP_001038978.1.86239 WP_001038978.1.86288 WP_001038978.1.8698 WP_001038978.1.8825 WP_001038978.1.88641 WP_001038978.1.90791 WP_001038978.1.9186 WP_001038978.1.92686 WP_001038978.1.92831 WP_001038978.1.93271 WP_001038978.1.93744 WP_001038978.1.93927 WP_001038978.1.94237 WP_001038978.1.94322 WP_001038978.1.94784 WP_001038978.1.96934 WP_001038978.1.97781 WP_001038978.1.97861 WP_001038978.1.98216 WP_001038978.1.99445 WP_001038978.1.99485 WP_001038978.1.99994 YP_029317.1.16718 gi|227813916|ref|YP_002813925.1| IDP02563 gi|30263213|ref|NP_845590.1| 198094.BA_3299 260799.BAS3060 261594.GBAA3299 568206.BAMEG_1322 592021.BAA_3338 gi|229602956|ref|YP_002867476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]