SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IDP02661 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IDP02661
Domain Number 1 Region: 55-245
Classification Level Classification E-value
Superfamily L domain-like 2.83e-20
Family Internalin LRR domain 0.0072
Further Details:      
 
Domain Number 2 Region: 382-429
Classification Level Classification E-value
Superfamily PKD domain 0.0000432
Family PKD domain 0.01
Further Details:      
 
Weak hits

Sequence:  IDP02661
Domain Number - Region: 462-506
Classification Level Classification E-value
Superfamily PKD domain 0.00746
Family PKD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) IDP02661
Sequence length 593
Comment $ CSGID $ SQ192152 $ PDBT350810 $
Sequence
MMSIKSNIMKIGVCSVMVLVPLSQTSLPSFAAEEIALKESQDVVNIPDPQLKKELNLYLN
QAENADITEAQMATFRNITLNSGIKDLTGIEYLKNITTLSINNINASYEPIQTLSSLEKL
VINGENVNADIIPDLSVLSNLTFLDLSRTNIDDTIFSKISNIPNLNKLDISNNKGITKIS
ELNNLPSLQELRVSDCQITNFKGIEKFPNLTAFYGDGQLFGIDSFETDGFKNIKSSELTF
DANAKTLFVPFSIVTVNTILNYDGLSLPYNTNPDYTSIALGDQSYVVTNDKISINQQGIT
LSDFTQADFDELEAFEVYLGFDSGNISKPANLANGTYSLKQIGSYRAFSVDHSVNITAQD
NISYIQNDTVTPEKFLTDIKADANGGTITSDLTDKVDFTKPGNYTVTLNAQNTKGLKGEP
IQVTVTIIEKTVITADPEVTYDLNEAITEEEFLAEIKATTNDDTMITSDFESAVDFTKAG
EYIVTLNAENDTQKAAPLTVKIRVNPKLPDPVVPIPYPDPTPDPTPDPTVPVPTPEDSTS
DDGGVQHSNSRNPRISISDSSLEKLPKTGDSLPESGVLLGFLTLALGIVIRKK
Download sequence
Identical sequences A0A1D2IVS1 A0A2G8Q375 A0A2G8QCX0 A0A2G8QYQ8 Q8Y7I8
NP_464814.1.42710 WP_010989724.1.100229 WP_010989724.1.11266 WP_010989724.1.11313 WP_010989724.1.11326 WP_010989724.1.11712 WP_010989724.1.21133 WP_010989724.1.23254 WP_010989724.1.24370 WP_010989724.1.24972 WP_010989724.1.26350 WP_010989724.1.26632 WP_010989724.1.26891 WP_010989724.1.28747 WP_010989724.1.29550 WP_010989724.1.30227 WP_010989724.1.32210 WP_010989724.1.32402 WP_010989724.1.32622 WP_010989724.1.3324 WP_010989724.1.33875 WP_010989724.1.364 WP_010989724.1.37518 WP_010989724.1.39887 WP_010989724.1.41281 WP_010989724.1.43619 WP_010989724.1.45983 WP_010989724.1.48358 WP_010989724.1.48999 WP_010989724.1.50236 WP_010989724.1.50334 WP_010989724.1.52447 WP_010989724.1.52867 WP_010989724.1.52989 WP_010989724.1.54160 WP_010989724.1.55238 WP_010989724.1.55683 WP_010989724.1.55740 WP_010989724.1.58177 WP_010989724.1.59045 WP_010989724.1.5973 WP_010989724.1.60166 WP_010989724.1.60369 WP_010989724.1.62663 WP_010989724.1.62972 WP_010989724.1.63951 WP_010989724.1.6397 WP_010989724.1.64200 WP_010989724.1.64227 WP_010989724.1.6460 WP_010989724.1.648 WP_010989724.1.6579 WP_010989724.1.66005 WP_010989724.1.66039 WP_010989724.1.66311 WP_010989724.1.66338 WP_010989724.1.66512 WP_010989724.1.66884 WP_010989724.1.67301 WP_010989724.1.67709 WP_010989724.1.69471 WP_010989724.1.70992 WP_010989724.1.71468 WP_010989724.1.72636 WP_010989724.1.74217 WP_010989724.1.74450 WP_010989724.1.74754 WP_010989724.1.75541 WP_010989724.1.77681 WP_010989724.1.79630 WP_010989724.1.79964 WP_010989724.1.80036 WP_010989724.1.81261 WP_010989724.1.82440 WP_010989724.1.82667 WP_010989724.1.83260 WP_010989724.1.8418 WP_010989724.1.84833 WP_010989724.1.85203 WP_010989724.1.86484 WP_010989724.1.86597 WP_010989724.1.87536 WP_010989724.1.88485 WP_010989724.1.89386 WP_010989724.1.90829 WP_010989724.1.91556 WP_010989724.1.92132 WP_010989724.1.92409 WP_010989724.1.94758 WP_010989724.1.97820 WP_010989724.1.9894 WP_010989724.1.99512 WP_010989724.1.99520 WP_010989724.1.99786 gi|405758336|ref|YP_006687612.1| IDP02661 169963.lmo1289 gi|386050265|ref|YP_005968256.1| gi|16803329|ref|NP_464814.1| gi|404283780|ref|YP_006684677.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]