SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IDP04382 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IDP04382
Domain Number 1 Region: 167-330
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.93e-28
Family Histidine kinase 0.01
Further Details:      
 
Weak hits

Sequence:  IDP04382
Domain Number - Region: 106-173
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00051
Family Homodimeric domain of signal transducing histidine kinase 0.0055
Further Details:      
 
Domain Number - Region: 19-73,205-230
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0628
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) IDP04382
Sequence length 337
Comment $ CSGID $ SQ214202 $ PDBT351359 $
Sequence
MNLRDFIKERIVFIIINSLILLFTALLLMVLKVDSFAILFIVIINEAGILIYHIFDYLRK
KQYYNEIKENMESLDKKYLISEVIEEGTFTESKLIYDVICKGNKAMNDEIGEFKRGINDY
REYIELWVHEIKTPIATCKLLIENNESPLTESIGEEVCKLENYIDQALFYTRSNTLEKDY
IIKEMSLSSCVNKVLNNNADSLIKKRVKISLGDLEKQVYSDSKWIEFILGQIISNSIKYM
NKEHKELKIYCNENSKYVILNIEDNGAGISEKDISRVFDKGFTGENGRKFGKSTGIGLYL
CKKLCKKLGLDIKLISEEGKFTRVSIIFPINRMMIFE
Download sequence
Identical sequences A0A0H2YUG0
195103.CPF_0116 IDP04382 WP_011590065.1.50147 gi|110801065|ref|YP_694580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]