SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IDP05412 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IDP05412
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.67e-28
Family Collagen-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 4.05e-23
Family PKD domain 0.00074
Further Details:      
 
Weak hits

Sequence:  IDP05412
Domain Number - Region: 187-295
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0889
Family 14-3-3 protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) IDP05412
Sequence length 971
Comment $ CSGID $ SQ239068 $ PDBT352116 $
Sequence
MKGYSKKVLVGVSFASLMLGSFQGGALAEGTKGEQASYRNVLKMEPVGVQLPVQELAHSS
KVLENKSFEKRLQFADLSQRPPELKKESKQLATAKTYTIAELNQLSNQQLVDLLVTIDWE
QITGLFQFNKDSLAFYQNDSRIQAIIDKLKQQGQDYTKDDSKGIETLVEVLRSGFYLGFY
HTELSKLNERSYHDKCLPALKTIANNANFKLGTLEQNRVVSSYGKLIGNASSDVETITSA
AKIFKQYNDNFSTWVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPKDTVWYQKIDSYIN
ELSRFALIGTVTEKNGWLINNGIYYTGRLGTFHSTGTKGLQVVTDAMKMYPYLGEQYFVA
AEQIATNYGGKDANGNVVNLDQIREDGKKKYLPKTYTFDDGTIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNADDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKIYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGISSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKVHDLIRKNDVTAYDAYRSALSKDANLNKEYQDYMQMLVDNRDKYNVPLVSDDYLA
THAPKPVSDIVAEITAEAKLSNVSVKKNKSQFFHTFTLQGTYTGTTAKGEYEDWKSITQN
VNDTLKRLSAKEWTGYKTVTAYFVNYRVNASGQFEYDVVFHGMNTEEGAVNKAPVAVING
PYSGNVNEAISFKSDGSKDEDGKIVAYKWEFGDGTVSNEQNPTHVYTKEGTYTARLTVTD
DKGLTNTVTTNVTVQKKEDNSVEKEPNNSFQTANTLQFNQVLRASLGNGDTSDFFEINVE
TAKNLQINVTKENNIGVNWVLYSEADLNNYITYAQQEGNKLVGSYYTYPGKYYLHVYQYG
GGFGNYTVEVK
Download sequence
Identical sequences Q81YG5
gi|30263477|ref|NP_845854.1| IDP05412 gi|386737280|ref|YP_006210461.1| NP_845854.1.87267 WP_000679557.1.100214 WP_000679557.1.100595 WP_000679557.1.10208 WP_000679557.1.11427 WP_000679557.1.11676 WP_000679557.1.13115 WP_000679557.1.13820 WP_000679557.1.14721 WP_000679557.1.14855 WP_000679557.1.15460 WP_000679557.1.15569 WP_000679557.1.16170 WP_000679557.1.16997 WP_000679557.1.17146 WP_000679557.1.18976 WP_000679557.1.19258 WP_000679557.1.19435 WP_000679557.1.20390 WP_000679557.1.20680 WP_000679557.1.21021 WP_000679557.1.21258 WP_000679557.1.21776 WP_000679557.1.22865 WP_000679557.1.23269 WP_000679557.1.2419 WP_000679557.1.24334 WP_000679557.1.24556 WP_000679557.1.24608 WP_000679557.1.25716 WP_000679557.1.25752 WP_000679557.1.2618 WP_000679557.1.26665 WP_000679557.1.26721 WP_000679557.1.27644 WP_000679557.1.27987 WP_000679557.1.28427 WP_000679557.1.28729 WP_000679557.1.29101 WP_000679557.1.29787 WP_000679557.1.30110 WP_000679557.1.31490 WP_000679557.1.3236 WP_000679557.1.32576 WP_000679557.1.33338 WP_000679557.1.33367 WP_000679557.1.33740 WP_000679557.1.33876 WP_000679557.1.34646 WP_000679557.1.35684 WP_000679557.1.35886 WP_000679557.1.36305 WP_000679557.1.36763 WP_000679557.1.38036 WP_000679557.1.39781 WP_000679557.1.41165 WP_000679557.1.4439 WP_000679557.1.45305 WP_000679557.1.45533 WP_000679557.1.46236 WP_000679557.1.46699 WP_000679557.1.47145 WP_000679557.1.4763 WP_000679557.1.47798 WP_000679557.1.52794 WP_000679557.1.53137 WP_000679557.1.53493 WP_000679557.1.53683 WP_000679557.1.54117 WP_000679557.1.54189 WP_000679557.1.55811 WP_000679557.1.55958 WP_000679557.1.56176 WP_000679557.1.56270 WP_000679557.1.58160 WP_000679557.1.59095 WP_000679557.1.59310 WP_000679557.1.59575 WP_000679557.1.60402 WP_000679557.1.61213 WP_000679557.1.63560 WP_000679557.1.68607 WP_000679557.1.69203 WP_000679557.1.69822 WP_000679557.1.69894 WP_000679557.1.70065 WP_000679557.1.70996 WP_000679557.1.72704 WP_000679557.1.73325 WP_000679557.1.74226 WP_000679557.1.74538 WP_000679557.1.75499 WP_000679557.1.75870 WP_000679557.1.76125 WP_000679557.1.76783 WP_000679557.1.77668 WP_000679557.1.77824 WP_000679557.1.78644 WP_000679557.1.79315 WP_000679557.1.79584 WP_000679557.1.80695 WP_000679557.1.81799 WP_000679557.1.82289 WP_000679557.1.83951 WP_000679557.1.84045 WP_000679557.1.85689 WP_000679557.1.86119 WP_000679557.1.86140 WP_000679557.1.86239 WP_000679557.1.86288 WP_000679557.1.8698 WP_000679557.1.8825 WP_000679557.1.88641 WP_000679557.1.90791 WP_000679557.1.9186 WP_000679557.1.92686 WP_000679557.1.92831 WP_000679557.1.93271 WP_000679557.1.93744 WP_000679557.1.93927 WP_000679557.1.94237 WP_000679557.1.94322 WP_000679557.1.94784 WP_000679557.1.97781 WP_000679557.1.97861 WP_000679557.1.98216 WP_000679557.1.99445 YP_029580.1.16718 198094.BA_3584 260799.BAS3323 261594.GBAA3584 568206.BAMEG_1049 592021.BAA_3612 gi|229603262|ref|YP_002867722.1| gi|49186328|ref|YP_029580.1| gi|47528869|ref|YP_020218.1| gi|227813645|ref|YP_002813654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]