SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IDP05426 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IDP05426
Domain Number 1 Region: 71-216
Classification Level Classification E-value
Superfamily L domain-like 2.81e-19
Family Internalin LRR domain 0.005
Further Details:      
 
Domain Number 2 Region: 379-423
Classification Level Classification E-value
Superfamily PKD domain 0.0000012
Family PKD domain 0.0068
Further Details:      
 
Weak hits

Sequence:  IDP05426
Domain Number - Region: 457-503
Classification Level Classification E-value
Superfamily PKD domain 0.0373
Family PKD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) IDP05426
Sequence length 589
Comment $ CSGID $ SQ239082 $ PDBT352130 $
Sequence
MKKMGVKIGLCILLIMPFTISFSANVSAEENISIKAAQDVVNIPDPALKSYLNGLLGQPS
TSDITEAQMDTITDVTISNASLTDLTGLDYAHNLTILHLTNTGVTDYSLVANIPSLTNLN
ISGSNLTTNSIPDLNGLTNVTNLNLSSGKLDNSALTKFNKLPNLTFLNLDNNPSITDFMP
LKSLPNLASLFIQFCGVNDFRGIDSFPKLTNLAAFGQNVGSAILINSTIKSSALNYNEAN
QTIFVPFTLMTERSMNFDGYLFPFTTNTASSSTYFTLNGVQISGSRLSIDDTGVTVSGIT
KDFFDSITKMEYNAFYDNPAGSYNSPPNFNSYSVSSGTYDHYFDIDHSLTITNDSAISYG
EQTTVTEEQFLKDVHAETDDGTPVTSDFNTIVDFSKPGVYTVTLNAENAAGLKATPTQVT
VTILAKPVITADKSISYTKDTTKTEQQFLQDIAAKTSDGSKVTSDFDSVVDLAKVGTYKV
TLNAVSADGLNADPVIILVNVVAGNEPPTPPGPGPDPTPDPTPNPNNPNINPNPDNGQSA
KSEIASNPSNSEVNIALPNTGDASQATTVLIGIILAGVAILFFRKRKHS
Download sequence
Identical sequences A0A1D2IXV5 A0A2G8QML3 A0A2G8R2S9 Q8Y9C2
gi|404283049|ref|YP_006683946.1| gi|386049537|ref|YP_005967528.1| 169963.lmo0610 gi|405757604|ref|YP_006686880.1| NP_464137.1.42710 WP_010989528.1.11266 WP_010989528.1.11313 WP_010989528.1.11712 WP_010989528.1.13160 WP_010989528.1.17228 WP_010989528.1.17695 WP_010989528.1.178 WP_010989528.1.21133 WP_010989528.1.23254 WP_010989528.1.24370 WP_010989528.1.24972 WP_010989528.1.26350 WP_010989528.1.26632 WP_010989528.1.26891 WP_010989528.1.28402 WP_010989528.1.28747 WP_010989528.1.30227 WP_010989528.1.30267 WP_010989528.1.305 WP_010989528.1.31584 WP_010989528.1.32210 WP_010989528.1.32402 WP_010989528.1.32622 WP_010989528.1.3324 WP_010989528.1.33336 WP_010989528.1.33875 WP_010989528.1.34851 WP_010989528.1.364 WP_010989528.1.39887 WP_010989528.1.41281 WP_010989528.1.42672 WP_010989528.1.43619 WP_010989528.1.4371 WP_010989528.1.45983 WP_010989528.1.48358 WP_010989528.1.50236 WP_010989528.1.50334 WP_010989528.1.50883 WP_010989528.1.52447 WP_010989528.1.52867 WP_010989528.1.54160 WP_010989528.1.55238 WP_010989528.1.55683 WP_010989528.1.55740 WP_010989528.1.56759 WP_010989528.1.58069 WP_010989528.1.58177 WP_010989528.1.5973 WP_010989528.1.60166 WP_010989528.1.60219 WP_010989528.1.60369 WP_010989528.1.62663 WP_010989528.1.6397 WP_010989528.1.64200 WP_010989528.1.64227 WP_010989528.1.6460 WP_010989528.1.648 WP_010989528.1.6579 WP_010989528.1.66005 WP_010989528.1.66039 WP_010989528.1.66311 WP_010989528.1.66338 WP_010989528.1.66512 WP_010989528.1.66884 WP_010989528.1.67301 WP_010989528.1.67709 WP_010989528.1.69471 WP_010989528.1.69631 WP_010989528.1.70690 WP_010989528.1.70992 WP_010989528.1.71468 WP_010989528.1.72051 WP_010989528.1.72566 WP_010989528.1.72636 WP_010989528.1.74217 WP_010989528.1.74450 WP_010989528.1.74754 WP_010989528.1.75541 WP_010989528.1.75670 WP_010989528.1.77681 WP_010989528.1.77823 WP_010989528.1.78167 WP_010989528.1.78336 WP_010989528.1.79184 WP_010989528.1.79212 WP_010989528.1.79630 WP_010989528.1.79964 WP_010989528.1.80036 WP_010989528.1.81261 WP_010989528.1.82440 WP_010989528.1.83137 WP_010989528.1.83215 WP_010989528.1.83260 WP_010989528.1.83546 WP_010989528.1.8418 WP_010989528.1.85203 WP_010989528.1.86484 WP_010989528.1.86597 WP_010989528.1.87536 WP_010989528.1.88485 WP_010989528.1.89386 WP_010989528.1.8988 WP_010989528.1.90829 WP_010989528.1.91556 WP_010989528.1.92132 WP_010989528.1.92409 WP_010989528.1.93920 WP_010989528.1.94032 WP_010989528.1.94758 WP_010989528.1.95945 WP_010989528.1.96940 WP_010989528.1.97390 WP_010989528.1.97820 WP_010989528.1.98193 WP_010989528.1.99026 WP_010989528.1.99512 WP_010989528.1.99520 WP_010989528.1.99785 WP_010989528.1.99786 gi|16802652|ref|NP_464137.1| IDP05426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]