SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IDP05690 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IDP05690
Domain Number 1 Region: 887-997
Classification Level Classification E-value
Superfamily PKD domain 0.00000212
Family PKD domain 0.0087
Further Details:      
 
Domain Number 2 Region: 1130-1238
Classification Level Classification E-value
Superfamily PKD domain 0.0000667
Family PKD domain 0.012
Further Details:      
 
Weak hits

Sequence:  IDP05690
Domain Number - Region: 1033-1082
Classification Level Classification E-value
Superfamily PKD domain 0.000559
Family PKD domain 0.013
Further Details:      
 
Domain Number - Region: 1527-1633
Classification Level Classification E-value
Superfamily PKD domain 0.00137
Family PKD domain 0.012
Further Details:      
 
Domain Number - Region: 1353-1400
Classification Level Classification E-value
Superfamily PKD domain 0.00379
Family PKD domain 0.014
Further Details:      
 
Domain Number - Region: 1447-1555
Classification Level Classification E-value
Superfamily PKD domain 0.00654
Family PKD domain 0.012
Further Details:      
 
Domain Number - Region: 1272-1319
Classification Level Classification E-value
Superfamily PKD domain 0.00798
Family PKD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) IDP05690
Sequence length 1711
Comment $ CSGID $ SQ239332 $ PDBT352394 $
Sequence
MKSKFFIGMMTFLLSLICLTGMKAEAKSVGDISPDDISPEISDNRFQSAEGKVLPNFEVD
MSISDQNNGKLSIDEDFELTSDGDIILIGTVQGQYIQGTPILNENGQLNKIPNRDQGIIM
RVDRTTKKVEWARVVNYEDGNYNSQYAADKWFSSYKSITTNSSKSTFYVGGEVVNYYGDS
GGGSTLIVKSIDANGNFQIAHKSYVSYGVPSRSDLTYAYFMDIQMEGNTLTMSASARYAA
QGKQFIRYTLEPASLSITKNEFNPLDNTFWAKYQRTDVLKVDNKGLMAYNADVNGANQLK
MSIRESENNYKEITLFDSVPEILANSSPYIFMEDRGDGNVFVVMSTPTTWYIALVNIASE
QVVETKKMTMNSSTTLNSVIYSEGKGLLLGGSTHAEESIFGSEPLNKNNGYYLALGNDLN
VTDSQILRTNQHNSLTTIINGVGNKVDGFFSYDGLNNDGYIQNVEYPNTYDVNPNGAMIF
AEFNLQPAPVLDTGNPILAFYQGERRADFDELEGVKAYSGIDSSDVTKSITKNTFDLYTV
GVQQQLYQIEYLPGSGNKTTGTRNVQLIHPLETPKLEKSYADSHGAFKVGEVVPANAIHA
FNGLDSANNVTYVVTAVDDEKITVDASIKRTEGTKTAVINKEITLMTSTADETAVIDVTS
VALAAGKYTSLTDVRNEGHFHIYAETMDSVSIDPKYVKLTEDPENPVDWNAPGVYYVTAS
LDPASGYTAKDVKVSVAVVDVGSPKVISVNMKPYNPTTALVVAEDDINGAGVYKINWAIK
DANGLIIQQGVEESGATIRVQTPVPIDLSTLNDGNYTLSVSAADRIGHTSEASEKAFTVD
RQAPVVTADDKITYEINTKKTEEEFLNDVNVKTEAGAVIKTNFDTMVRMDSPGDYTVLVE
ATDAAGNQSDPIYVIVTVEDTVAPIISADEAISYNQGNIRTEALFLTDIHATTDEPATIT
SDFADQVKFDTPGVYAVTLKANDISGNQAIPRTVNVTIKDVTAPVITADEAIIYEKGITK
SATDFLTDIHATTNDGSAITSNFATVVDLNTPGDYDVTLSSTDTGGNISDPVTITVTVRD
TTPPVITADTTITYEKGTTKTAAAFLTDVNATTNDGSAVTSNFNPISLKQVGTYQVTLSS
VDENGNYALPVKVTVVVQDTQKPVISSSATSITYERGEKKQETGFFLDLAIKTDDGTPVT
SDFDTAVNLDTAGTYTVTLNSEDESGNKADPVTITVTVADTEKPIITADTTITYAKGTTK
TVAQFLTDIHATTNDGSTIISNFDPTVLAQEGTYTVVLNAKDESNNEADPVTVTITVVDT
KGPIINALNAITYERTINKNEADFLADIEATTDDGSTITTDFNSKDLDTVGTYIVTLNAE
DASGNKATPVKVTIKVEDTIPPIITADQSITYERGITKTEQAFYTDIKAATSDNSPISSD
FSKIDLTKTGNYEVLLRATDQSGNKALPLKINVLVQDTIAPVIKTTSREITAERGTPMTE
QQLLAKIGANTDDGSKITTDYNPAIVNTSGDYLVHLYAVDAAGNQAIPVEITIHVKDTTA
PIIKADKKISYPVGTVKTVTEFLQDIHATTDDGSKITTDFDPNMLKTPGKYTIHLNAVDA
DGNKAKTIDVSLTVEEKVTPPKPPTPDDGGNNTNGSNGTNGSNTDITVNPTKQNTTATNE
SIPALGDTKSTIPVIVGMFLLATSLVLIRRK
Download sequence
Identical sequences A0A1D2IRA8 A0A2G8Q3B9 A0A2G8QE43 A0A2G8QZW3 Q8Y6L8
gi|405758716|ref|YP_006687992.1| gi|16803706|ref|NP_465191.1| IDP05690 gi|386050642|ref|YP_005968633.1| NP_465191.1.42710 WP_010989777.1.11266 WP_010989777.1.11712 WP_010989777.1.17695 WP_010989777.1.21133 WP_010989777.1.23254 WP_010989777.1.24370 WP_010989777.1.24972 WP_010989777.1.26350 WP_010989777.1.26632 WP_010989777.1.26891 WP_010989777.1.28402 WP_010989777.1.28747 WP_010989777.1.30227 WP_010989777.1.305 WP_010989777.1.32210 WP_010989777.1.32402 WP_010989777.1.32622 WP_010989777.1.3324 WP_010989777.1.33875 WP_010989777.1.364 WP_010989777.1.43619 WP_010989777.1.45983 WP_010989777.1.48358 WP_010989777.1.48999 WP_010989777.1.50236 WP_010989777.1.50334 WP_010989777.1.50883 WP_010989777.1.52447 WP_010989777.1.52867 WP_010989777.1.54160 WP_010989777.1.55238 WP_010989777.1.55683 WP_010989777.1.55740 WP_010989777.1.58177 WP_010989777.1.59045 WP_010989777.1.5973 WP_010989777.1.60166 WP_010989777.1.60369 WP_010989777.1.62663 WP_010989777.1.6397 WP_010989777.1.64200 WP_010989777.1.64227 WP_010989777.1.6460 WP_010989777.1.648 WP_010989777.1.6579 WP_010989777.1.66005 WP_010989777.1.66039 WP_010989777.1.66311 WP_010989777.1.66338 WP_010989777.1.66512 WP_010989777.1.66884 WP_010989777.1.67301 WP_010989777.1.67709 WP_010989777.1.69471 WP_010989777.1.70992 WP_010989777.1.71468 WP_010989777.1.72051 WP_010989777.1.72636 WP_010989777.1.74217 WP_010989777.1.74450 WP_010989777.1.74754 WP_010989777.1.75541 WP_010989777.1.77681 WP_010989777.1.77823 WP_010989777.1.79630 WP_010989777.1.79964 WP_010989777.1.80036 WP_010989777.1.81261 WP_010989777.1.82440 WP_010989777.1.83260 WP_010989777.1.83546 WP_010989777.1.8418 WP_010989777.1.85203 WP_010989777.1.86484 WP_010989777.1.86597 WP_010989777.1.87536 WP_010989777.1.88485 WP_010989777.1.89386 WP_010989777.1.90829 WP_010989777.1.91556 WP_010989777.1.92132 WP_010989777.1.92409 WP_010989777.1.94758 WP_010989777.1.97390 WP_010989777.1.97820 WP_010989777.1.98193 WP_010989777.1.9894 WP_010989777.1.99512 WP_010989777.1.99520 WP_010989777.1.99786 169963.lmo1666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]