SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lmaj003743AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lmaj003743AAA
Domain Number 1 Region: 439-533
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000294
Family Anti-sigma factor antagonist SpoIIaa 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lmaj003743AAA
Sequence length 744
Comment $ SGPP $ SQ65847 $ PDBT223951 $
Sequence
MTYVYRFVPVSRWYRLLTPKIILSDSIAGFIVGVMIVPTCLSWSSLAGLPFSCGLIAALV
ASFSYGTFGQCASLSIGPVAEITTLLISIPGIPVAERKDTFQSLGLQVGILSMVLSFVDC
GTVIKTIFAKAVGDGYTCAAALLAISAQLKVMFNVVPEDKGYGNFINTLITLGTQMSAKS
LYCFVIFMVYCTYLIQIKKVALPLWIPHQLIVVVVSTLVTWGFRLDELLDLAIVRDIPAV
LSWPRFPPMDNLIGLGPYTLTITVIIFVQMYVVAQRVMPNIDPNTELFAGGITNLLVNLM
SGMPVSNSFSCSSVLIEQKVHTPLTAYATGAVVLITILFLTRLGVFYYLPKQALAAIVVS
SVWRLVNFSGPVQLWRYSRKDAGVWVLTFLLTLIGGITIGVLSGIAFSLILVVLRIARPR
AVSVGFNMQTFRYGDIRKDPELLVYPNILMWRFDAPLYFINIGYFQERLIAAIAAEVRPI
DVVIVTCGKVVDIDAAALASLPFILDYTSKSDPTRPRRIILTDIHGRLEKVLLASAALPI
YVPEEYDRISIEQITASGKFPVVFKKLEEAIAFGQRCISERYGNVDTAPYPNVSFLTDVV
MEAARLPAGDGCVPSFLSLLEAENATPAAAAAPLSSNSLHIVVTAPGEASPESSRAEDGR
GKAARAEASISSPRLPRNSAAASADLPRPNVDDDNDDGDDGDDGAPPQQQQDSLVRHLAT
LKKLSTALFSVNPHRHTRTRTCTR
Download sequence
Identical sequences Lmaj003743AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]