SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MaR143 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MaR143
Domain Number 1 Region: 32-258
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.73e-29
Family Chondroitinase B 0.075
Further Details:      
 
Domain Number 2 Region: 237-314
Classification Level Classification E-value
Superfamily PKD domain 1.7e-20
Family PKD domain 0.00045
Further Details:      
 
Domain Number 3 Region: 322-402
Classification Level Classification E-value
Superfamily PKD domain 1.44e-16
Family PKD domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MaR143
Sequence length 572
Comment $ NESG $ SQ85025 $ PDBT128842 $
Sequence
MNAKTIERTCFLLAILILILVPDVGMASELHVKAGESIQGVVDKALPGDTIFIEPGEFNE
SILINKENLTIKSSSGNPDNTIIKGINAESYVFEITAIGVNISGFSITEGRCGVFLNRVD
NCTVNDNKISNLEAGIYLFESSNNLLSNNMVYSNLDCGIKLLSSPDNVIYRNYFNNTNNA
RDNKFNTWNDSRGNYWSDYEGSDENGDGIGDSAYAVNPEAGSMDYMPLMEYLHSSPVLPT
ARFTSDITEGFAPLSVRFKDFSENATSRLWMFGDGNTSDSPSPLHTFFNEGEYIVSLIVS
NENDSDSASVTIRALNASRQSDPVLPEAKLISNATGGRVPLVIKFVDLSRNADCITWSFG
DGKKSCCPEPEHTFCCPGNYTVSLVAGNENGTSTTCIAISVLKNETDMNTKENLEGEEAS
GTENKGLIGCITRYIGGTSDEVQDDNEVQDESIDAEATGNSEPENESKRIIQGIIHKGEL
ESIKSSVVSTKDSVVSAVSSKVHTETGISLENGTLRVQKSIEGFIDNHAPESSKNSLPEM
KKRIAPWVPSFLGLAGVAFMVSMLKRGRRSRK
Download sequence
Identical sequences Q8PSA4
WP_011035073.1.13782 WP_011035073.1.49674 WP_011035073.1.90340 gi|21229280|ref|NP_635202.1| MaR143 192952.MM_3178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]