SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MaR158 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MaR158
Domain Number 1 Region: 21-316
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.76e-35
Family Pectin methylesterase 0.016
Further Details:      
 
Domain Number 2 Region: 329-431
Classification Level Classification E-value
Superfamily PKD domain 3.53e-25
Family PKD domain 0.00052
Further Details:      
 
Domain Number 3 Region: 436-520
Classification Level Classification E-value
Superfamily PKD domain 1.83e-19
Family PKD domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MaR158
Sequence length 767
Comment $ NESG $ SQ85040 $ PDBT128827 $
Sequence
MKGKTLLIVFTLVFLIGIPSTVSARDIIVGSGSGQISTIQEAVDVAEAGDVILIKPGTYV
ENINVSKERLTIKPETNNVFIGPKDSTVATIILSNVGTTLTGFNIRGNVIANIWASDRSS
EYQINNPTHITNNIIEDGGVVVQSESSAVTISGNIISGYGIDVACCGDYNEITNNEVSNC
STGIYVYDERNVPPISGNKIRNCDVGIHVSGLSYDLENNEITNCGVGVLAGETGGANLTG
NKITYCSDCGLKVTGSIESKGAYNNYFNNTVNVKFGEFEETYVWNSSRTEGTNIIGGPYM
GGNYWAKPDGTGFSQTAVDANRDGIADSAYAISKKNYDYLPLTAVYNPVLPVFDFTANVT
SGTAPLVVLFTASGTGGSSASWLWDFGDGINSKHAMNATHTFTDPGTYTVGLIVENSAGN
STVVKTNYIVVTDSDVVVPGVPIADFSCNVTEGYAPLAVQFNDSSQNAASRTWDFNNDGV
IDSDGLAPVYVYKSPGTYFVNLTITNPNGLSYKIDTITVLDGSRDDSSSGSGGSSKRGSS
GSSGGGGGSPEPAKNVKVKELCQVFITNGKEVKFDFTKKATCVVYASFDAKKTAGKTTTI
AEELKGRSALVSELPEGEVYKSFNVWVGNSGYATPKNIENSEVCFKVEKSWVQEKDMDQA
SITLNTYRDKKWEQLPVSLSEEDDEFLYFTAETPGFSSFAITAKAADIDKGTETGSNFGS
EAALADAENIEDEPESGTVQKESVNTPGFVAIYGLAGLLAVFLYRRK
Download sequence
Identical sequences Q8PUN7
192952.MM_2295 MaR158 WP_011034220.1.49674 WP_011034220.1.90340 gi|21228397|ref|NP_634319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]