SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MaR160 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MaR160
Domain Number 1 Region: 41-312
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.77e-48
Family iota-carrageenase 0.043
Further Details:      
 
Domain Number 2 Region: 343-428
Classification Level Classification E-value
Superfamily PKD domain 8.76e-21
Family PKD domain 0.00025
Further Details:      
 
Domain Number 3 Region: 434-515
Classification Level Classification E-value
Superfamily PKD domain 1.31e-18
Family PKD domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MaR160
Sequence length 792
Comment $ NESG $ SQ85042 $ PDBT128825 $
Sequence
MSYHCSSCAKKFSGVFLVWKMKRELSILFTLVLAFQVITGSTAAMTLYVDDDGTGNYTTI
QSAVNAAVNGDTIIVNPGTYEGDITLDTSSLRIQSQSENPEDTVIQGNGFYLTQNAQRIA
IKGFTLKGTGSSYAIALEEYADSIIENNIILDHGTGIDTNIYSTFTINDNDISSCGTGIY
VGECYFNAIINNNRVSKCGTGITVGDLGYPQIESNIIAENGQGIALMYEGGATIVGNTIT
SNKESGIFHNGHGGSTIYNNNFYNSNNIIFGEYHDFPDMWNTTRTAENNIVGGPYIAGNY
WAKPDGKGFSQTHYDLNGDGIAEQPYYIDEKEIDYLPLVTPGTETEPVLPEADFRANTTY
GSVPLTVAFTDLSKNAVSWRWDFNDNGKYDSVEQNPVFVYGYPADFTVNLTVINENGTST
KTAVITVLKKEAPILPAANFNANTTTGYPPLSVLFTDLSQNAASRSWDANGDGIKDSGET
SFVYVYNTAGTYTSNLTVSNSNGTASKTATIIVLEATNSGGSSNDGSNEGGSSNDGSNEG
GSSSGGSSSGGSSSGSSSGGGGGGSPEPARNVKTKEISQTFIQNGKAVKFDFTKNATCVV
YVGFDPKKNAGKTTTIVEELKSKSTLVSKIPGGETYKSFNVWVGNSGFASSKNIENPVIC
FKVEKSWIRDKNIDPDSIVLNRYSDKKWSKLEAKLSEEDDKFLYFIAHVPGFSFFVITGE
AAGSAGNISREENGLETRALQGEDDGTAGSNAGTNSGQKEKMKFPDASPVYSIAGILLLS
LICILIYKTIPK
Download sequence
Identical sequences A0A0E3PW46 A0A0E3REM0 A0A0E3RUF5 Q8PZV5
MaR160 192952.MM_0384 gi|21226486|ref|NP_632408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]