SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MaR168 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MaR168
Domain Number 1 Region: 18-280
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.56e-41
Family Pectate transeliminase 0.024
Further Details:      
 
Domain Number 2 Region: 638-725
Classification Level Classification E-value
Superfamily PKD domain 4.19e-26
Family PKD domain 0.00012
Further Details:      
 
Domain Number 3 Region: 284-471
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.4e-21
Family Pectate transeliminase 0.093
Further Details:      
 
Domain Number 4 Region: 733-812
Classification Level Classification E-value
Superfamily PKD domain 5.23e-19
Family PKD domain 0.0005
Further Details:      
 
Domain Number 5 Region: 446-604
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.11e-18
Family iota-carrageenase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MaR168
Sequence length 1052
Comment $ NESG $ SQ85050 $ PDBT128817 $
Sequence
MTGGIRINRIRILILATLILTLSSCAGAAADIYVNSTDSIQAAVTAANQGDVIIVDPGTY
TENVDINGKTNLLIKSSADPADTVIAPADVNKDVITIRNSNTITIQGLNITGAGNDKAGI
YVYKSNNCKVENNILHNDALGIYLKGSDFTLVRNNIATKNNNPGTGRAINIEQSNYTDVL
SNSVLNQRYGIYVSDSRANRVLENTVNLSRDNGIHVQYATNITVENNRLNSNGMYGIILS
NSNENFLRSNNVFNSTNNSIEVYTSSGNEISDNIVSDSSIDTLTHGIHLNTAYNNVLRNN
TVSKNDYGIAMIYSNNNNVVNNTASDNNRGIYLAYTSSANTVSGNKAHSSLNGGIVLQNC
SNNNIISNEATLNTGGSTTNGIILGGASNNNVSNNIASENRRGIYITSGSSGNKVSGNTL
NSNTGHGIYLENAGTDNNLSSNVASSNGVYGIYLVNSNNTALFNNIATGNSKGIYVMTSN
GNTISENEVYNNNVDVDNSNGIMISLSSNNKVSGNKAYNNPYGISLNSSTNNNISSNRVY
LNSRAGVYLCRQSTRNLIFNNYLNNSVNADNNNNLSTWNVTKTSGRNIAGGSNIGGNYWA
DPVQYNDHSQIYKNNDADGDGIIDIIYEGDQLTDYLPLLEVYLVLPEADFSTNVTQGYAP
LTVEFTDLSQNAIGWNWDFGDGASSPEKNTTHTYSTAGNYTVTLRANNLNGTASKTAAIA
VLQPEQGGNGSAVLPVADFTANVTRGYYPLTVLFTDTSQNSVSRSWDVNGDGIEDSNETS
FVYTYNFRGIYTAKLTAFNANGTTEKTATITVDKESSGGSSGGGGGGGSPEPAKNVEVKE
LSQVFVSNGKAIKFDFAKNATCVYYVGFDSKKTVGKTTTIAEQLKNKSTLVSNLSDGEVY
RYFNVWVGNSGFASSSNIENPEIGFKVDKSWVTDKNIDQDSITLNRYSDKKWEQIPASLL
KEDSKYLYFTADVPGYTFFAITGKANTSPEKTVTETEADKPANEPVNSDDLPGDAGLEPA
PESDKKENTAMPGFEIVCGIVSLSAAFMYRRK
Download sequence
Identical sequences Q8Q0S0
gi|21226168|ref|NP_632090.1| 192952.MM_0066 MaR168 WP_011032020.1.49674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]