SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MvR215 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MvR215
Domain Number 1 Region: 30-204
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.04e-28
Family Pectin methylesterase 0.048
Further Details:      
 
Domain Number 2 Region: 235-317
Classification Level Classification E-value
Superfamily PKD domain 8.37e-25
Family PKD domain 0.00024
Further Details:      
 
Domain Number 3 Region: 323-405
Classification Level Classification E-value
Superfamily PKD domain 5.36e-19
Family PKD domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MvR215
Sequence length 597
Comment $ NESG $ SQ207299 $ PDBT161552 $
Sequence
MAQTQTFRRTCFLLAIFILISVSGIGTASEFRVWPGQSIQDAVDSASPGDIILVESGEFN
ESIRVNKENLTIESASGNPDDIFIAGDTPISYVFEVVANDVKINFFSITDGRCGIFLNNV
ENCVINGNKISNQEAGIYLLNSRNNLLTNNMVYSNEDCGLKLLASSENIIYGNYFDNVEN
ARDNRFNVWNNSKGNYWSDYGGTDENGDGIGDTPYAINPEVGSMDYRPLIEYSQEAPILP
KALFTSDVTEGYAPLVVRFKDFSEDAASRLWDFGDGNFSSYPNPQHTYLNEGTYVVSLTV
SNENGSDSASVTVYVRDASELAGPMLPKAQFIYNTTSGHIPLVIKFVDISENADCVTWYF
GDGKTSCCPEPEHTFCCPGSYTVSLAAINENGTSSASIVVNVLPAESVESSEDTENSANT
GSGSDKNNACNIVNETDADASEKAGDPELITRSENTDSLGNSIIEYASDTTDKFADAENS
INAEATENSESDSNGGGEGTGTARIIHREELEAIKDSVISTASSNILKETERALENETLK
VQKNVEDFVDDSLPESVGDSLPEMEQRIAPWIPSFLGLAGVIFIVSVMKRGRRRRQK
Download sequence
Identical sequences Q8TLV8
188937.MA2916 MvR215 gi|20091736|ref|NP_617811.1| WP_011022864.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]